Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BT12

Protein Details
Accession A0A1Y2BT12   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-35PTAHGKRSGAARRKLRKERQAQLDAQHydrophilic
NLS Segment(s)
PositionSequence
14-27GKRSGAARRKLRKE
Subcellular Location(s) mito 19, cyto 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF12937  F-box-like  
Amino Acid Sequences MEATPHLQQPTAHGKRSGAARRKLRKERQAQLDAQFANLEIDPKKGPKLPAELVYHIMCLSKPPPADFHSKQAQDHRRFLCRLSLVCSLWREEAQKLLWKLVFLRTEQHVEGFLSGGAKMHLTEELAIGGVEEGSDSPMNGELVNKVLARTADLFVLSVNKVVDFDPTALTRANFTSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.49
4 0.53
5 0.51
6 0.55
7 0.61
8 0.69
9 0.79
10 0.86
11 0.87
12 0.87
13 0.87
14 0.88
15 0.87
16 0.84
17 0.79
18 0.72
19 0.69
20 0.58
21 0.49
22 0.39
23 0.29
24 0.23
25 0.18
26 0.17
27 0.1
28 0.13
29 0.14
30 0.15
31 0.18
32 0.21
33 0.23
34 0.25
35 0.31
36 0.32
37 0.37
38 0.39
39 0.38
40 0.37
41 0.35
42 0.31
43 0.24
44 0.21
45 0.14
46 0.12
47 0.11
48 0.12
49 0.12
50 0.13
51 0.16
52 0.19
53 0.28
54 0.27
55 0.32
56 0.36
57 0.38
58 0.39
59 0.45
60 0.52
61 0.49
62 0.55
63 0.52
64 0.49
65 0.48
66 0.47
67 0.42
68 0.35
69 0.3
70 0.28
71 0.28
72 0.24
73 0.25
74 0.25
75 0.21
76 0.2
77 0.2
78 0.17
79 0.13
80 0.15
81 0.14
82 0.18
83 0.18
84 0.19
85 0.18
86 0.16
87 0.17
88 0.2
89 0.2
90 0.16
91 0.18
92 0.18
93 0.21
94 0.21
95 0.2
96 0.16
97 0.14
98 0.14
99 0.11
100 0.09
101 0.07
102 0.06
103 0.06
104 0.05
105 0.05
106 0.05
107 0.05
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.05
115 0.05
116 0.04
117 0.04
118 0.03
119 0.03
120 0.03
121 0.05
122 0.05
123 0.05
124 0.06
125 0.07
126 0.08
127 0.08
128 0.08
129 0.07
130 0.09
131 0.11
132 0.11
133 0.1
134 0.12
135 0.12
136 0.14
137 0.16
138 0.15
139 0.13
140 0.13
141 0.13
142 0.12
143 0.15
144 0.12
145 0.12
146 0.11
147 0.1
148 0.11
149 0.11
150 0.14
151 0.13
152 0.14
153 0.15
154 0.16
155 0.17
156 0.19
157 0.19
158 0.18