Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2FXW4

Protein Details
Accession A0A1Y2FXW4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
129-148KNWLERRRTRRVKSSNPTQTHydrophilic
NLS Segment(s)
PositionSequence
6-43RGARSAVRGSRRRVGVRGVGEDGGRKKRVSGGRGRRRR
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MPERERGARSAVRGSRRRVGVRGVGEDGGRKKRVSGGRGRRRRVAATMTLPPSFSAFSNPISPSLSHSCINCFPSTQSPALTPVFTTPSTNPNPFTCAGLKRIQLARMQDRRNGTRRREVVDAGDVGEKNWLERRRTRRVKSSNPTQTPGSFNPTSPTLNAKLAATSAPLIQSLFSSFRLISSFPPPPPPSFPSPNSLRFSNRVENHQHPIHPNCPCNSGKTANKPALELALTLELSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.61
3 0.64
4 0.65
5 0.59
6 0.59
7 0.57
8 0.55
9 0.52
10 0.47
11 0.41
12 0.37
13 0.39
14 0.39
15 0.38
16 0.36
17 0.32
18 0.3
19 0.37
20 0.43
21 0.45
22 0.5
23 0.54
24 0.62
25 0.72
26 0.77
27 0.76
28 0.74
29 0.7
30 0.65
31 0.6
32 0.56
33 0.51
34 0.53
35 0.49
36 0.44
37 0.41
38 0.35
39 0.31
40 0.24
41 0.19
42 0.16
43 0.14
44 0.16
45 0.2
46 0.2
47 0.2
48 0.21
49 0.21
50 0.22
51 0.25
52 0.26
53 0.23
54 0.23
55 0.25
56 0.27
57 0.3
58 0.25
59 0.21
60 0.2
61 0.24
62 0.27
63 0.24
64 0.21
65 0.2
66 0.23
67 0.23
68 0.2
69 0.15
70 0.13
71 0.15
72 0.15
73 0.16
74 0.14
75 0.2
76 0.24
77 0.25
78 0.26
79 0.23
80 0.26
81 0.24
82 0.26
83 0.22
84 0.2
85 0.22
86 0.24
87 0.24
88 0.26
89 0.27
90 0.27
91 0.27
92 0.3
93 0.35
94 0.39
95 0.4
96 0.4
97 0.42
98 0.46
99 0.52
100 0.54
101 0.49
102 0.5
103 0.51
104 0.5
105 0.48
106 0.42
107 0.36
108 0.3
109 0.26
110 0.18
111 0.18
112 0.14
113 0.12
114 0.12
115 0.1
116 0.09
117 0.15
118 0.18
119 0.19
120 0.27
121 0.35
122 0.44
123 0.54
124 0.59
125 0.64
126 0.69
127 0.76
128 0.77
129 0.8
130 0.79
131 0.73
132 0.71
133 0.63
134 0.56
135 0.5
136 0.44
137 0.4
138 0.3
139 0.26
140 0.26
141 0.26
142 0.25
143 0.2
144 0.23
145 0.18
146 0.19
147 0.2
148 0.17
149 0.15
150 0.15
151 0.14
152 0.11
153 0.09
154 0.08
155 0.08
156 0.08
157 0.08
158 0.07
159 0.07
160 0.09
161 0.1
162 0.1
163 0.12
164 0.11
165 0.12
166 0.13
167 0.14
168 0.14
169 0.19
170 0.23
171 0.22
172 0.31
173 0.33
174 0.35
175 0.39
176 0.42
177 0.43
178 0.45
179 0.46
180 0.45
181 0.48
182 0.53
183 0.51
184 0.49
185 0.47
186 0.45
187 0.49
188 0.51
189 0.49
190 0.48
191 0.52
192 0.54
193 0.57
194 0.56
195 0.54
196 0.51
197 0.54
198 0.55
199 0.54
200 0.54
201 0.48
202 0.5
203 0.47
204 0.45
205 0.45
206 0.46
207 0.47
208 0.53
209 0.6
210 0.6
211 0.6
212 0.56
213 0.52
214 0.47
215 0.39
216 0.29
217 0.23
218 0.2