Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NT28

Protein Details
Accession G9NT28    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
58-84IHVRDGPRPGRPKKKKEQLKEQRVEQGBasic
NLS Segment(s)
PositionSequence
64-74PRPGRPKKKKE
Subcellular Location(s) nucl 14.5, cyto_nucl 12, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Pfam View protein in Pfam  
PF13384  HTH_23  
Amino Acid Sequences MPAHDIATRAQALTLKLLGVSNQDIQRLTGIHPRTVHNIMDRAIERGLDLNNPTILEIHVRDGPRPGRPKKKKEQLKEQRVEQGTVVGEHRPLIALPSASLQKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.13
3 0.13
4 0.13
5 0.12
6 0.12
7 0.14
8 0.17
9 0.18
10 0.19
11 0.19
12 0.19
13 0.2
14 0.18
15 0.18
16 0.19
17 0.2
18 0.22
19 0.23
20 0.25
21 0.29
22 0.31
23 0.3
24 0.26
25 0.26
26 0.23
27 0.25
28 0.24
29 0.2
30 0.18
31 0.16
32 0.13
33 0.12
34 0.12
35 0.09
36 0.1
37 0.09
38 0.09
39 0.09
40 0.09
41 0.08
42 0.07
43 0.08
44 0.07
45 0.08
46 0.11
47 0.12
48 0.12
49 0.17
50 0.19
51 0.25
52 0.33
53 0.4
54 0.48
55 0.58
56 0.67
57 0.73
58 0.82
59 0.84
60 0.85
61 0.88
62 0.88
63 0.9
64 0.87
65 0.81
66 0.79
67 0.72
68 0.64
69 0.52
70 0.44
71 0.34
72 0.28
73 0.25
74 0.17
75 0.15
76 0.14
77 0.14
78 0.11
79 0.1
80 0.11
81 0.12
82 0.12
83 0.12
84 0.16