Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DM89

Protein Details
Accession A0A1Y2DM89   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
185-210PSKRGPPEPTVRQPKKPKLTEKEIETHydrophilic
NLS Segment(s)
PositionSequence
6-45RQQDKKRGGFKVGPKLGKGVYQGHAKKIKDTLIHKAKVKR
164-234PTKGKGSRRPPSAEAAPAPPAPSKRGPPEPTVRQPKKPKLTEKEIETIREKKAAERREWGKKGARGQPKLG
Subcellular Location(s) nucl 16, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MAGKPRQQDKKRGGFKVGPKLGKGVYQGHAKKIKDTLIHKAKVKRSYHKALAAEGYATGANGGGLGMRKAGKQAGRGGLDSDDDEEDGQDDTEMEGALGEEEKEEQRRKLRRELEGAQGMESDEEMDGGSDSDDDEGGRGGARQPKFVKQPVREPLPEIAYPGPTKGKGSRRPPSAEAAPAPPAPSKRGPPEPTVRQPKKPKLTEKEIETIREKKAAERREWGKKGARGQPKLGGRVEQLLGRIQRSMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.77
3 0.77
4 0.76
5 0.69
6 0.6
7 0.59
8 0.52
9 0.48
10 0.42
11 0.37
12 0.33
13 0.4
14 0.41
15 0.46
16 0.52
17 0.49
18 0.49
19 0.48
20 0.48
21 0.45
22 0.47
23 0.49
24 0.52
25 0.57
26 0.59
27 0.63
28 0.65
29 0.67
30 0.7
31 0.69
32 0.69
33 0.72
34 0.72
35 0.71
36 0.65
37 0.59
38 0.54
39 0.45
40 0.36
41 0.26
42 0.21
43 0.13
44 0.11
45 0.08
46 0.06
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.06
54 0.07
55 0.08
56 0.09
57 0.14
58 0.15
59 0.18
60 0.23
61 0.28
62 0.29
63 0.29
64 0.29
65 0.25
66 0.24
67 0.21
68 0.17
69 0.11
70 0.09
71 0.09
72 0.07
73 0.07
74 0.07
75 0.06
76 0.05
77 0.05
78 0.04
79 0.05
80 0.05
81 0.04
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.04
89 0.06
90 0.11
91 0.13
92 0.16
93 0.24
94 0.32
95 0.36
96 0.44
97 0.49
98 0.5
99 0.54
100 0.55
101 0.53
102 0.51
103 0.47
104 0.38
105 0.32
106 0.27
107 0.19
108 0.16
109 0.09
110 0.04
111 0.04
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.04
127 0.07
128 0.13
129 0.13
130 0.19
131 0.21
132 0.27
133 0.32
134 0.38
135 0.44
136 0.41
137 0.5
138 0.52
139 0.55
140 0.5
141 0.48
142 0.45
143 0.4
144 0.36
145 0.3
146 0.24
147 0.2
148 0.2
149 0.19
150 0.18
151 0.14
152 0.17
153 0.22
154 0.3
155 0.37
156 0.46
157 0.53
158 0.57
159 0.62
160 0.62
161 0.61
162 0.55
163 0.5
164 0.42
165 0.37
166 0.34
167 0.29
168 0.28
169 0.24
170 0.23
171 0.23
172 0.26
173 0.28
174 0.32
175 0.41
176 0.43
177 0.47
178 0.55
179 0.59
180 0.65
181 0.71
182 0.7
183 0.71
184 0.77
185 0.81
186 0.82
187 0.82
188 0.82
189 0.8
190 0.84
191 0.81
192 0.77
193 0.75
194 0.68
195 0.64
196 0.6
197 0.55
198 0.48
199 0.46
200 0.4
201 0.4
202 0.45
203 0.48
204 0.47
205 0.52
206 0.58
207 0.64
208 0.67
209 0.67
210 0.67
211 0.65
212 0.69
213 0.69
214 0.71
215 0.66
216 0.67
217 0.68
218 0.66
219 0.66
220 0.59
221 0.53
222 0.45
223 0.45
224 0.42
225 0.35
226 0.3
227 0.31
228 0.31
229 0.29