Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DB60

Protein Details
Accession A0A1Y2DB60   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
204-224AKEATSKKKKPGKPALGATKSHydrophilic
NLS Segment(s)
PositionSequence
57-77AAAKPAGPAPPVRQKGITKQK
202-218KAAKEATSKKKKPGKPA
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023194  eIF3-like_dom_sf  
IPR013906  eIF3j  
Gene Ontology GO:0016282  C:eukaryotic 43S preinitiation complex  
GO:0033290  C:eukaryotic 48S preinitiation complex  
GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0003743  F:translation initiation factor activity  
GO:0001732  P:formation of cytoplasmic translation initiation complex  
Pfam View protein in Pfam  
PF08597  eIF3_subunit  
Amino Acid Sequences MPSDWDASSDDESPAPAVAAPKVIKKSKYADEDASDDDVKDDWDASDDEEELAKKAAAAKPAGPAPPVRQKGITKQKIAEKEAAERAAAEARAARAQEDNDPLLRKQRERDAILKSDLDNATSLFGGASVQDDPFSQRCSTLPEFEALSETISELLIAKHGTHPLYAKFVESLVKGVCGPLKDNETRKAASGLTTLANEKQKAAKEATSKKKKPGKPALGATKSLGAGRADVGAYDEILDDSGDYDDFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.12
3 0.1
4 0.1
5 0.1
6 0.15
7 0.17
8 0.22
9 0.29
10 0.35
11 0.36
12 0.39
13 0.45
14 0.48
15 0.53
16 0.53
17 0.5
18 0.48
19 0.49
20 0.47
21 0.44
22 0.36
23 0.29
24 0.24
25 0.2
26 0.17
27 0.14
28 0.11
29 0.07
30 0.09
31 0.09
32 0.1
33 0.11
34 0.1
35 0.1
36 0.11
37 0.12
38 0.1
39 0.11
40 0.09
41 0.09
42 0.14
43 0.16
44 0.18
45 0.19
46 0.2
47 0.23
48 0.26
49 0.26
50 0.22
51 0.22
52 0.24
53 0.33
54 0.34
55 0.32
56 0.34
57 0.36
58 0.46
59 0.55
60 0.56
61 0.5
62 0.52
63 0.57
64 0.58
65 0.58
66 0.53
67 0.44
68 0.42
69 0.42
70 0.37
71 0.31
72 0.24
73 0.22
74 0.19
75 0.17
76 0.12
77 0.09
78 0.09
79 0.11
80 0.11
81 0.11
82 0.1
83 0.11
84 0.14
85 0.16
86 0.16
87 0.16
88 0.18
89 0.17
90 0.24
91 0.26
92 0.25
93 0.26
94 0.32
95 0.37
96 0.39
97 0.44
98 0.41
99 0.41
100 0.41
101 0.39
102 0.31
103 0.3
104 0.26
105 0.21
106 0.16
107 0.13
108 0.12
109 0.1
110 0.1
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.05
119 0.05
120 0.07
121 0.09
122 0.11
123 0.1
124 0.1
125 0.11
126 0.17
127 0.19
128 0.19
129 0.19
130 0.18
131 0.18
132 0.17
133 0.18
134 0.12
135 0.11
136 0.08
137 0.07
138 0.06
139 0.06
140 0.06
141 0.04
142 0.04
143 0.05
144 0.05
145 0.06
146 0.07
147 0.1
148 0.1
149 0.11
150 0.13
151 0.13
152 0.17
153 0.17
154 0.16
155 0.14
156 0.14
157 0.15
158 0.14
159 0.14
160 0.11
161 0.11
162 0.1
163 0.11
164 0.12
165 0.11
166 0.13
167 0.14
168 0.19
169 0.24
170 0.29
171 0.33
172 0.35
173 0.35
174 0.35
175 0.34
176 0.29
177 0.25
178 0.21
179 0.18
180 0.15
181 0.15
182 0.16
183 0.18
184 0.22
185 0.21
186 0.22
187 0.25
188 0.27
189 0.3
190 0.31
191 0.32
192 0.37
193 0.47
194 0.56
195 0.62
196 0.64
197 0.7
198 0.77
199 0.77
200 0.79
201 0.8
202 0.79
203 0.77
204 0.82
205 0.83
206 0.78
207 0.74
208 0.64
209 0.57
210 0.48
211 0.39
212 0.32
213 0.22
214 0.18
215 0.16
216 0.16
217 0.12
218 0.11
219 0.13
220 0.11
221 0.1
222 0.1
223 0.09
224 0.08
225 0.08
226 0.08
227 0.06
228 0.06
229 0.07