Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2FBM3

Protein Details
Accession A0A1Y2FBM3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-22LSKKDARTREQKKKEADGVKBasic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR026939  ZNF706/At2g23090_sf  
Amino Acid Sequences MGLSKKDARTREQKKKEADGVKVATTAGGVVKKAPKPMITCTVCKASIIATMPVSLRDHANKHAKVKPEECFPGAVIAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.79
3 0.81
4 0.77
5 0.7
6 0.66
7 0.59
8 0.52
9 0.45
10 0.36
11 0.27
12 0.2
13 0.16
14 0.1
15 0.08
16 0.07
17 0.09
18 0.14
19 0.16
20 0.18
21 0.2
22 0.21
23 0.23
24 0.26
25 0.33
26 0.31
27 0.31
28 0.31
29 0.33
30 0.3
31 0.27
32 0.23
33 0.15
34 0.15
35 0.15
36 0.14
37 0.11
38 0.12
39 0.12
40 0.14
41 0.14
42 0.12
43 0.13
44 0.16
45 0.18
46 0.25
47 0.35
48 0.37
49 0.43
50 0.47
51 0.52
52 0.56
53 0.58
54 0.56
55 0.55
56 0.56
57 0.5
58 0.47
59 0.4