Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2E6M4

Protein Details
Accession A0A1Y2E6M4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-32PPPSSRAEMPRARKRRRPTLQRIRSPPPRWHydrophilic
NLS Segment(s)
PositionSequence
12-26PRARKRRRPTLQRIR
Subcellular Location(s) nucl 15.5, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MTPPPSSRAEMPRARKRRRPTLQRIRSPPPRWSCSVAFTLPRALSSINPDATTSSRSPTTRTRTTSRSSFKSTRPAVNGGSPSSMGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.81
4 0.84
5 0.86
6 0.87
7 0.87
8 0.88
9 0.9
10 0.91
11 0.89
12 0.87
13 0.86
14 0.8
15 0.77
16 0.74
17 0.68
18 0.61
19 0.59
20 0.51
21 0.44
22 0.43
23 0.36
24 0.29
25 0.26
26 0.25
27 0.2
28 0.19
29 0.16
30 0.13
31 0.11
32 0.14
33 0.17
34 0.14
35 0.14
36 0.14
37 0.15
38 0.16
39 0.19
40 0.15
41 0.14
42 0.17
43 0.17
44 0.21
45 0.28
46 0.35
47 0.38
48 0.43
49 0.46
50 0.47
51 0.53
52 0.58
53 0.58
54 0.56
55 0.58
56 0.58
57 0.57
58 0.62
59 0.62
60 0.6
61 0.56
62 0.54
63 0.49
64 0.5
65 0.48
66 0.4
67 0.37
68 0.3