Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2DKZ8

Protein Details
Accession A0A1Y2DKZ8    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
63-88LVEEHRPRLQRTKRRRLWPSPSSSISHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 5, extr 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MATPVCFPSAAWARGGLKVRLITPISLLERSTSHWHRSLSALVPPSSALLLTSGAQEIRSWTLVEEHRPRLQRTKRRRLWPSPSSSIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.29
4 0.25
5 0.26
6 0.26
7 0.27
8 0.27
9 0.21
10 0.19
11 0.23
12 0.21
13 0.2
14 0.2
15 0.16
16 0.15
17 0.19
18 0.25
19 0.24
20 0.25
21 0.28
22 0.28
23 0.28
24 0.29
25 0.28
26 0.22
27 0.22
28 0.21
29 0.17
30 0.17
31 0.16
32 0.14
33 0.11
34 0.1
35 0.06
36 0.04
37 0.05
38 0.05
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.08
46 0.09
47 0.09
48 0.09
49 0.14
50 0.16
51 0.24
52 0.29
53 0.32
54 0.37
55 0.42
56 0.45
57 0.51
58 0.59
59 0.62
60 0.67
61 0.73
62 0.77
63 0.83
64 0.89
65 0.89
66 0.89
67 0.88
68 0.86