Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FN07

Protein Details
Accession A0A1Y2FN07    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSSRSSLQKRYRPRCRVESLTRPPFPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 9, cyto_nucl 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MSSRSSLQKRYRPRCRVESLTRPPFPSPSFFILTALNTTHPNSLPSTLLQYPSLIPGFPSCTLFPHFLVARSLRREVAQADLNVRHEELLELL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.83
4 0.81
5 0.81
6 0.8
7 0.81
8 0.75
9 0.69
10 0.62
11 0.57
12 0.49
13 0.43
14 0.36
15 0.31
16 0.31
17 0.28
18 0.28
19 0.24
20 0.23
21 0.2
22 0.16
23 0.13
24 0.11
25 0.12
26 0.12
27 0.12
28 0.12
29 0.12
30 0.13
31 0.12
32 0.11
33 0.14
34 0.13
35 0.14
36 0.13
37 0.13
38 0.12
39 0.13
40 0.13
41 0.09
42 0.08
43 0.08
44 0.11
45 0.11
46 0.14
47 0.12
48 0.14
49 0.17
50 0.18
51 0.18
52 0.19
53 0.19
54 0.18
55 0.21
56 0.23
57 0.26
58 0.29
59 0.3
60 0.27
61 0.27
62 0.28
63 0.26
64 0.27
65 0.27
66 0.24
67 0.27
68 0.3
69 0.31
70 0.31
71 0.3
72 0.24
73 0.19