Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CJ76

Protein Details
Accession A0A1Y2CJ76    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
89-130AEYQPSQIRRKRKHGFLCRKRTRNGRKTLERRWSKGRKFLSHBasic
NLS Segment(s)
PositionSequence
97-127RRKRKHGFLCRKRTRNGRKTLERRWSKGRKF
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MRTPRSSLLRSLLPTAAPVARLPTPVALLPASARPSLSTSSLSQLPYRPFSSLLTQRPSSSILSLLSAPSPFTASFAPQQQIRHATYGAEYQPSQIRRKRKHGFLCRKRTRNGRKTLERRWSKGRKFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.22
4 0.18
5 0.16
6 0.16
7 0.16
8 0.17
9 0.17
10 0.15
11 0.15
12 0.15
13 0.16
14 0.12
15 0.11
16 0.12
17 0.14
18 0.15
19 0.14
20 0.14
21 0.13
22 0.15
23 0.16
24 0.17
25 0.16
26 0.15
27 0.18
28 0.2
29 0.2
30 0.2
31 0.22
32 0.23
33 0.24
34 0.24
35 0.22
36 0.21
37 0.21
38 0.26
39 0.29
40 0.31
41 0.32
42 0.32
43 0.31
44 0.31
45 0.32
46 0.26
47 0.19
48 0.15
49 0.11
50 0.11
51 0.11
52 0.1
53 0.08
54 0.07
55 0.07
56 0.06
57 0.07
58 0.06
59 0.07
60 0.07
61 0.09
62 0.11
63 0.14
64 0.15
65 0.16
66 0.18
67 0.2
68 0.24
69 0.24
70 0.23
71 0.21
72 0.19
73 0.18
74 0.2
75 0.18
76 0.16
77 0.15
78 0.15
79 0.2
80 0.24
81 0.3
82 0.32
83 0.42
84 0.47
85 0.58
86 0.65
87 0.69
88 0.76
89 0.81
90 0.87
91 0.87
92 0.91
93 0.91
94 0.89
95 0.88
96 0.88
97 0.88
98 0.86
99 0.86
100 0.85
101 0.86
102 0.88
103 0.9
104 0.9
105 0.87
106 0.84
107 0.84
108 0.85
109 0.81
110 0.81