Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DZD8

Protein Details
Accession A0A1Y2DZD8   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPPTNKKRPPPSKKGRSTSLLHydrophilic
NLS Segment(s)
PositionSequence
6-17KKRPPPSKKGRS
Subcellular Location(s) nucl 16, mito 10
Family & Domain DBs
Amino Acid Sequences MPPTNKKRPPPSKKGRSTSLLPKIRSHTSSLPLKSSVQPQLRTKKQKEAQKARDATARDGMNGTEQDWRHELVQEAAKETSPLVQPKPAPPKELANKGGELADALKELEVAMSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.86
3 0.8
4 0.76
5 0.76
6 0.75
7 0.71
8 0.64
9 0.61
10 0.59
11 0.59
12 0.54
13 0.49
14 0.43
15 0.42
16 0.47
17 0.44
18 0.42
19 0.38
20 0.38
21 0.35
22 0.36
23 0.38
24 0.36
25 0.39
26 0.44
27 0.52
28 0.59
29 0.66
30 0.64
31 0.66
32 0.67
33 0.69
34 0.72
35 0.73
36 0.72
37 0.72
38 0.71
39 0.63
40 0.6
41 0.54
42 0.46
43 0.4
44 0.32
45 0.22
46 0.2
47 0.19
48 0.16
49 0.14
50 0.13
51 0.13
52 0.13
53 0.15
54 0.15
55 0.16
56 0.15
57 0.16
58 0.16
59 0.14
60 0.19
61 0.17
62 0.18
63 0.18
64 0.17
65 0.16
66 0.16
67 0.16
68 0.15
69 0.18
70 0.17
71 0.21
72 0.23
73 0.31
74 0.42
75 0.41
76 0.4
77 0.4
78 0.48
79 0.52
80 0.58
81 0.54
82 0.47
83 0.45
84 0.43
85 0.41
86 0.31
87 0.23
88 0.16
89 0.13
90 0.1
91 0.1
92 0.09
93 0.08
94 0.08