Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EY27

Protein Details
Accession A0A1Y2EY27    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
130-171PGPAGRRARGREKPRHPLNPGEEGGRPRRGVRRLRWRKVRRGBasic
NLS Segment(s)
PositionSequence
132-171PAGRRARGREKPRHPLNPGEEGGRPRRGVRRLRWRKVRRG
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MSQQQAQSKARSSAPPAEVPSHRTTTTSTSTTASTSTSNGPFPPFLTSRPSTSPQHLPPLPPLPPLPNIHPTARLYHEGKLPEEGGGGGGLRPPFFGLGEAQGTAEGSRETSADQDGGEEGGGESEVGTPGPAGRRARGREKPRHPLNPGEEGGRPRRGVRRLRWRKVRRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.46
3 0.44
4 0.46
5 0.44
6 0.46
7 0.45
8 0.41
9 0.37
10 0.33
11 0.32
12 0.32
13 0.35
14 0.31
15 0.27
16 0.24
17 0.25
18 0.24
19 0.22
20 0.18
21 0.14
22 0.14
23 0.17
24 0.17
25 0.18
26 0.18
27 0.19
28 0.18
29 0.18
30 0.21
31 0.18
32 0.18
33 0.24
34 0.25
35 0.26
36 0.3
37 0.34
38 0.32
39 0.36
40 0.41
41 0.37
42 0.44
43 0.42
44 0.39
45 0.39
46 0.41
47 0.37
48 0.32
49 0.3
50 0.24
51 0.27
52 0.28
53 0.27
54 0.27
55 0.29
56 0.28
57 0.3
58 0.29
59 0.27
60 0.28
61 0.28
62 0.25
63 0.24
64 0.27
65 0.25
66 0.24
67 0.22
68 0.2
69 0.15
70 0.13
71 0.11
72 0.07
73 0.06
74 0.05
75 0.04
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.06
84 0.05
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.07
91 0.06
92 0.06
93 0.04
94 0.04
95 0.05
96 0.05
97 0.05
98 0.06
99 0.07
100 0.07
101 0.07
102 0.07
103 0.06
104 0.06
105 0.06
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.06
118 0.09
119 0.14
120 0.16
121 0.2
122 0.28
123 0.34
124 0.44
125 0.52
126 0.6
127 0.65
128 0.73
129 0.8
130 0.82
131 0.85
132 0.79
133 0.79
134 0.74
135 0.72
136 0.64
137 0.56
138 0.5
139 0.47
140 0.49
141 0.46
142 0.42
143 0.39
144 0.46
145 0.51
146 0.57
147 0.61
148 0.67
149 0.72
150 0.82
151 0.88