Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2EVP6

Protein Details
Accession A0A1Y2EVP6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
91-116HRPVGMKKTTIKRRKRVPPAANAQVSHydrophilic
NLS Segment(s)
PositionSequence
96-111MKKTTIKRRKRVPPAA
119-125PREERKR
Subcellular Location(s) mito 18, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039355  Transcription_factor_GATA  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS00344  GATA_ZN_FINGER_1  
PS50114  GATA_ZN_FINGER_2  
CDD cd00202  ZnF_GATA  
Amino Acid Sequences CTSCGATSTPLWRRSAEGLILCNACGEQAMALTAAAVAGAEAEGKTTNAGDVGVMECFNCQTRTTPLWRRDGEGRVACNACGLYYKLHNAHRPVGMKKTTIKRRKRVPPAANAQVSAEPREERKRGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.36
4 0.3
5 0.28
6 0.3
7 0.29
8 0.26
9 0.22
10 0.18
11 0.13
12 0.1
13 0.08
14 0.04
15 0.04
16 0.05
17 0.05
18 0.05
19 0.05
20 0.04
21 0.04
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.04
31 0.04
32 0.04
33 0.04
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.05
41 0.05
42 0.05
43 0.04
44 0.05
45 0.06
46 0.07
47 0.07
48 0.08
49 0.12
50 0.15
51 0.22
52 0.3
53 0.34
54 0.4
55 0.4
56 0.42
57 0.42
58 0.43
59 0.43
60 0.38
61 0.34
62 0.3
63 0.3
64 0.27
65 0.23
66 0.2
67 0.13
68 0.12
69 0.11
70 0.1
71 0.11
72 0.15
73 0.2
74 0.25
75 0.29
76 0.31
77 0.34
78 0.38
79 0.41
80 0.4
81 0.43
82 0.4
83 0.39
84 0.43
85 0.5
86 0.55
87 0.6
88 0.67
89 0.69
90 0.77
91 0.85
92 0.88
93 0.88
94 0.86
95 0.86
96 0.86
97 0.86
98 0.78
99 0.68
100 0.59
101 0.53
102 0.46
103 0.38
104 0.32
105 0.25
106 0.29
107 0.37