Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DL45

Protein Details
Accession A0A1Y2DL45   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-47MAATTIPRIKKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
8-47RIKKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKG
Subcellular Location(s) nucl 11, mito_nucl 10.333, cyto_nucl 9.833, mito 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAATTIPRIKKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNAKTRHVLPNGYKRFLVNNARDVELLLMHNGSFAAEIAHGVSSRKRIEIVEKARVVSWEMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.91
4 0.93
5 0.93
6 0.92
7 0.91
8 0.87
9 0.85
10 0.81
11 0.73
12 0.64
13 0.58
14 0.55
15 0.53
16 0.56
17 0.56
18 0.51
19 0.49
20 0.49
21 0.54
22 0.58
23 0.58
24 0.59
25 0.6
26 0.69
27 0.78
28 0.82
29 0.75
30 0.72
31 0.7
32 0.66
33 0.66
34 0.62
35 0.62
36 0.62
37 0.64
38 0.57
39 0.51
40 0.45
41 0.34
42 0.3
43 0.23
44 0.2
45 0.24
46 0.24
47 0.24
48 0.26
49 0.27
50 0.29
51 0.29
52 0.3
53 0.27
54 0.37
55 0.41
56 0.41
57 0.39
58 0.34
59 0.34
60 0.37
61 0.39
62 0.32
63 0.34
64 0.34
65 0.35
66 0.34
67 0.32
68 0.25
69 0.18
70 0.15
71 0.09
72 0.08
73 0.07
74 0.07
75 0.06
76 0.06
77 0.05
78 0.04
79 0.04
80 0.04
81 0.05
82 0.05
83 0.06
84 0.06
85 0.08
86 0.1
87 0.15
88 0.17
89 0.18
90 0.19
91 0.2
92 0.28
93 0.37
94 0.42
95 0.46
96 0.46
97 0.46
98 0.46
99 0.45