FuNGI

A0A1Y2F5A6

Protein Details

Accession

A0A1Y2F5A6

Localization Confidence

Medium

Confidence Score

13.5

NoLS Segment(s)

Position	Sequence	Protein Nature
4-25	GEMRGRRRGSSQRRVDWKLQGS	Hydrophilic
90-126	LLPSVQMRDKWRKKRVRRLKRKRRKMRARYAAGPPVA	Basic

NLS Segment(s)

Position	Sequence
99-118	KWRKKRVRRLKRKRRKMRAR
359-366	ARLPRRRR

Subcellular Location(s)

plas 12, mito 6, nucl 4, E.R. 2, cyto 1, extr 1, vacu 1

Family & Domain DBs

InterPro	View protein in InterPro IPR007836 Ribosomal_L41
Gene Ontology	GO:0016020 C:membrane GO:1990904 C:ribonucleoprotein complex GO:0005840 C:ribosome GO:0003735 F:structural constituent of ribosome GO:0006412 P:translation
Pfam	View protein in Pfam PF05162 Ribosomal_L41

Amino Acid Sequences

MAAGEMRGRRRGSSQRRVDWKLQGSLVEIQAYLELESVVEAGCGGKSRGVDVDFAAGASSLLELGRTSRVTSLSFPPLVAHLNLHDTKLLLPSVQMRDKWRKKRVRRLKRKRRKMRARYAAGPPVAGCDASLRGCSSSFRFNDAVAIADYALPAVLELCTTSSSDCTLSTASPKEVRRAFLLSKDVFRPLLSTILRTIIFLLTLIAWGISSALLRRQSKSSVLPYLSLIFLVIALLQTFFIYRAARQLYLPFRRRYLSTLPHLRRQLDPRTTDGKTVDYAPKGLVKQFERWCLFYKPEQVLPPAPLPPIPMYSPGVARDLDAVTLEVLADRAVSQGVAPSYGSIEMSSSSLLERGPPPARLPRRRRPASLASISSMTTPTSPSPSPSLLPTSSPSFRPFCPHTTSSQARPTLSRSSSVLSTATAASSSTSLRSSVGGDFGMGFGSQSTERLLLPAPVAGRDGSVGDGRRSSLVSAAGSVDARIESRRK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.67
2	0.7
3	0.79
4	0.83
5	0.82
6	0.81
7	0.76
8	0.71
9	0.63
10	0.54
11	0.48
12	0.46
13	0.4
14	0.32
15	0.25
16	0.19
17	0.18
18	0.17
19	0.14
20	0.09
21	0.08
22	0.06
23	0.07
24	0.07
25	0.05
26	0.04
27	0.04
28	0.05
29	0.05
30	0.07
31	0.08
32	0.1
33	0.1
34	0.12
35	0.16
36	0.16
37	0.17
38	0.16
39	0.19
40	0.16
41	0.16
42	0.14
43	0.1
44	0.09
45	0.08
46	0.07
47	0.04
48	0.04
49	0.05
50	0.05
51	0.06
52	0.1
53	0.11
54	0.12
55	0.14
56	0.16
57	0.18
58	0.22
59	0.26
60	0.28
61	0.28
62	0.27
63	0.25
64	0.25
65	0.26
66	0.23
67	0.18
68	0.13
69	0.2
70	0.21
71	0.21
72	0.19
73	0.17
74	0.18
75	0.19
76	0.18
77	0.11
78	0.12
79	0.17
80	0.24
81	0.28
82	0.3
83	0.35
84	0.46
85	0.56
86	0.66
87	0.7
88	0.74
89	0.8
90	0.88
91	0.92
92	0.92
93	0.94
94	0.95
95	0.96
96	0.97
97	0.97
98	0.97
99	0.97
100	0.97
101	0.97
102	0.96
103	0.96
104	0.92
105	0.88
106	0.84
107	0.8
108	0.69
109	0.59
110	0.47
111	0.39
112	0.31
113	0.24
114	0.16
115	0.1
116	0.11
117	0.11
118	0.12
119	0.1
120	0.1
121	0.11
122	0.13
123	0.14
124	0.21
125	0.21
126	0.24
127	0.24
128	0.24
129	0.25
130	0.23
131	0.22
132	0.14
133	0.14
134	0.09
135	0.09
136	0.08
137	0.06
138	0.06
139	0.04
140	0.03
141	0.03
142	0.03
143	0.03
144	0.03
145	0.04
146	0.05
147	0.05
148	0.06
149	0.06
150	0.07
151	0.08
152	0.08
153	0.09
154	0.09
155	0.09
156	0.12
157	0.14
158	0.16
159	0.21
160	0.22
161	0.28
162	0.3
163	0.31
164	0.3
165	0.33
166	0.31
167	0.3
168	0.35
169	0.3
170	0.3
171	0.3
172	0.29
173	0.25
174	0.23
175	0.2
176	0.14
177	0.19
178	0.16
179	0.16
180	0.15
181	0.17
182	0.17
183	0.16
184	0.16
185	0.1
186	0.09
187	0.08
188	0.08
189	0.05
190	0.05
191	0.04
192	0.03
193	0.03
194	0.03
195	0.03
196	0.03
197	0.03
198	0.04
199	0.07
200	0.13
201	0.15
202	0.17
203	0.19
204	0.2
205	0.23
206	0.27
207	0.28
208	0.27
209	0.26
210	0.25
211	0.24
212	0.23
213	0.2
214	0.16
215	0.12
216	0.06
217	0.06
218	0.05
219	0.04
220	0.03
221	0.03
222	0.03
223	0.03
224	0.03
225	0.03
226	0.04
227	0.05
228	0.06
229	0.06
230	0.1
231	0.11
232	0.12
233	0.12
234	0.17
235	0.23
236	0.32
237	0.38
238	0.35
239	0.36
240	0.37
241	0.37
242	0.37
243	0.36
244	0.34
245	0.36
246	0.44
247	0.46
248	0.51
249	0.53
250	0.5
251	0.48
252	0.48
253	0.48
254	0.44
255	0.43
256	0.41
257	0.43
258	0.42
259	0.4
260	0.35
261	0.28
262	0.22
263	0.24
264	0.23
265	0.18
266	0.18
267	0.16
268	0.19
269	0.18
270	0.19
271	0.21
272	0.2
273	0.27
274	0.3
275	0.37
276	0.36
277	0.37
278	0.4
279	0.37
280	0.38
281	0.34
282	0.37
283	0.32
284	0.33
285	0.33
286	0.32
287	0.31
288	0.3
289	0.28
290	0.23
291	0.2
292	0.17
293	0.17
294	0.16
295	0.16
296	0.14
297	0.15
298	0.16
299	0.16
300	0.17
301	0.17
302	0.17
303	0.15
304	0.14
305	0.13
306	0.12
307	0.11
308	0.09
309	0.08
310	0.07
311	0.06
312	0.06
313	0.04
314	0.04
315	0.04
316	0.03
317	0.03
318	0.04
319	0.04
320	0.04
321	0.04
322	0.06
323	0.06
324	0.07
325	0.07
326	0.06
327	0.07
328	0.08
329	0.08
330	0.06
331	0.06
332	0.06
333	0.07
334	0.07
335	0.06
336	0.06
337	0.07
338	0.07
339	0.09
340	0.09
341	0.15
342	0.18
343	0.19
344	0.23
345	0.32
346	0.42
347	0.5
348	0.59
349	0.63
350	0.71
351	0.76
352	0.77
353	0.75
354	0.74
355	0.73
356	0.7
357	0.62
358	0.53
359	0.48
360	0.44
361	0.36
362	0.28
363	0.19
364	0.13
365	0.12
366	0.12
367	0.15
368	0.16
369	0.18
370	0.21
371	0.22
372	0.23
373	0.24
374	0.27
375	0.23
376	0.25
377	0.25
378	0.28
379	0.28
380	0.29
381	0.31
382	0.3
383	0.3
384	0.35
385	0.36
386	0.35
387	0.4
388	0.4
389	0.4
390	0.46
391	0.5
392	0.49
393	0.53
394	0.51
395	0.46
396	0.46
397	0.46
398	0.45
399	0.42
400	0.38
401	0.32
402	0.32
403	0.31
404	0.3
405	0.26
406	0.18
407	0.18
408	0.16
409	0.14
410	0.11
411	0.1
412	0.09
413	0.1
414	0.1
415	0.1
416	0.1
417	0.11
418	0.11
419	0.12
420	0.13
421	0.13
422	0.14
423	0.13
424	0.12
425	0.12
426	0.11
427	0.11
428	0.08
429	0.07
430	0.06
431	0.08
432	0.08
433	0.09
434	0.1
435	0.11
436	0.11
437	0.13
438	0.14
439	0.13
440	0.13
441	0.15
442	0.14
443	0.14
444	0.16
445	0.14
446	0.13
447	0.12
448	0.12
449	0.12
450	0.16
451	0.17
452	0.18
453	0.19
454	0.2
455	0.21
456	0.21
457	0.2
458	0.18
459	0.19
460	0.17
461	0.17
462	0.17
463	0.17
464	0.16
465	0.16
466	0.14
467	0.12
468	0.12

A0A1Y2F5A6

3D AlphaFold-predicted Structure Viewer