Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2F5A6

Protein Details
Accession A0A1Y2F5A6   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-25GEMRGRRRGSSQRRVDWKLQGSHydrophilic
90-126LLPSVQMRDKWRKKRVRRLKRKRRKMRARYAAGPPVABasic
NLS Segment(s)
PositionSequence
99-118KWRKKRVRRLKRKRRKMRAR
359-366ARLPRRRR
Subcellular Location(s) plas 12, mito 6, nucl 4, E.R. 2, cyto 1, extr 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:0016020  C:membrane  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MAAGEMRGRRRGSSQRRVDWKLQGSLVEIQAYLELESVVEAGCGGKSRGVDVDFAAGASSLLELGRTSRVTSLSFPPLVAHLNLHDTKLLLPSVQMRDKWRKKRVRRLKRKRRKMRARYAAGPPVAGCDASLRGCSSSFRFNDAVAIADYALPAVLELCTTSSSDCTLSTASPKEVRRAFLLSKDVFRPLLSTILRTIIFLLTLIAWGISSALLRRQSKSSVLPYLSLIFLVIALLQTFFIYRAARQLYLPFRRRYLSTLPHLRRQLDPRTTDGKTVDYAPKGLVKQFERWCLFYKPEQVLPPAPLPPIPMYSPGVARDLDAVTLEVLADRAVSQGVAPSYGSIEMSSSSLLERGPPPARLPRRRRPASLASISSMTTPTSPSPSPSLLPTSSPSFRPFCPHTTSSQARPTLSRSSSVLSTATAASSSTSLRSSVGGDFGMGFGSQSTERLLLPAPVAGRDGSVGDGRRSSLVSAAGSVDARIESRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.7
3 0.79
4 0.83
5 0.82
6 0.81
7 0.76
8 0.71
9 0.63
10 0.54
11 0.48
12 0.46
13 0.4
14 0.32
15 0.25
16 0.19
17 0.18
18 0.17
19 0.14
20 0.09
21 0.08
22 0.06
23 0.07
24 0.07
25 0.05
26 0.04
27 0.04
28 0.05
29 0.05
30 0.07
31 0.08
32 0.1
33 0.1
34 0.12
35 0.16
36 0.16
37 0.17
38 0.16
39 0.19
40 0.16
41 0.16
42 0.14
43 0.1
44 0.09
45 0.08
46 0.07
47 0.04
48 0.04
49 0.05
50 0.05
51 0.06
52 0.1
53 0.11
54 0.12
55 0.14
56 0.16
57 0.18
58 0.22
59 0.26
60 0.28
61 0.28
62 0.27
63 0.25
64 0.25
65 0.26
66 0.23
67 0.18
68 0.13
69 0.2
70 0.21
71 0.21
72 0.19
73 0.17
74 0.18
75 0.19
76 0.18
77 0.11
78 0.12
79 0.17
80 0.24
81 0.28
82 0.3
83 0.35
84 0.46
85 0.56
86 0.66
87 0.7
88 0.74
89 0.8
90 0.88
91 0.92
92 0.92
93 0.94
94 0.95
95 0.96
96 0.97
97 0.97
98 0.97
99 0.97
100 0.97
101 0.97
102 0.96
103 0.96
104 0.92
105 0.88
106 0.84
107 0.8
108 0.69
109 0.59
110 0.47
111 0.39
112 0.31
113 0.24
114 0.16
115 0.1
116 0.11
117 0.11
118 0.12
119 0.1
120 0.1
121 0.11
122 0.13
123 0.14
124 0.21
125 0.21
126 0.24
127 0.24
128 0.24
129 0.25
130 0.23
131 0.22
132 0.14
133 0.14
134 0.09
135 0.09
136 0.08
137 0.06
138 0.06
139 0.04
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.04
146 0.05
147 0.05
148 0.06
149 0.06
150 0.07
151 0.08
152 0.08
153 0.09
154 0.09
155 0.09
156 0.12
157 0.14
158 0.16
159 0.21
160 0.22
161 0.28
162 0.3
163 0.31
164 0.3
165 0.33
166 0.31
167 0.3
168 0.35
169 0.3
170 0.3
171 0.3
172 0.29
173 0.25
174 0.23
175 0.2
176 0.14
177 0.19
178 0.16
179 0.16
180 0.15
181 0.17
182 0.17
183 0.16
184 0.16
185 0.1
186 0.09
187 0.08
188 0.08
189 0.05
190 0.05
191 0.04
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.04
199 0.07
200 0.13
201 0.15
202 0.17
203 0.19
204 0.2
205 0.23
206 0.27
207 0.28
208 0.27
209 0.26
210 0.25
211 0.24
212 0.23
213 0.2
214 0.16
215 0.12
216 0.06
217 0.06
218 0.05
219 0.04
220 0.03
221 0.03
222 0.03
223 0.03
224 0.03
225 0.03
226 0.04
227 0.05
228 0.06
229 0.06
230 0.1
231 0.11
232 0.12
233 0.12
234 0.17
235 0.23
236 0.32
237 0.38
238 0.35
239 0.36
240 0.37
241 0.37
242 0.37
243 0.36
244 0.34
245 0.36
246 0.44
247 0.46
248 0.51
249 0.53
250 0.5
251 0.48
252 0.48
253 0.48
254 0.44
255 0.43
256 0.41
257 0.43
258 0.42
259 0.4
260 0.35
261 0.28
262 0.22
263 0.24
264 0.23
265 0.18
266 0.18
267 0.16
268 0.19
269 0.18
270 0.19
271 0.21
272 0.2
273 0.27
274 0.3
275 0.37
276 0.36
277 0.37
278 0.4
279 0.37
280 0.38
281 0.34
282 0.37
283 0.32
284 0.33
285 0.33
286 0.32
287 0.31
288 0.3
289 0.28
290 0.23
291 0.2
292 0.17
293 0.17
294 0.16
295 0.16
296 0.14
297 0.15
298 0.16
299 0.16
300 0.17
301 0.17
302 0.17
303 0.15
304 0.14
305 0.13
306 0.12
307 0.11
308 0.09
309 0.08
310 0.07
311 0.06
312 0.06
313 0.04
314 0.04
315 0.04
316 0.03
317 0.03
318 0.04
319 0.04
320 0.04
321 0.04
322 0.06
323 0.06
324 0.07
325 0.07
326 0.06
327 0.07
328 0.08
329 0.08
330 0.06
331 0.06
332 0.06
333 0.07
334 0.07
335 0.06
336 0.06
337 0.07
338 0.07
339 0.09
340 0.09
341 0.15
342 0.18
343 0.19
344 0.23
345 0.32
346 0.42
347 0.5
348 0.59
349 0.63
350 0.71
351 0.76
352 0.77
353 0.75
354 0.74
355 0.73
356 0.7
357 0.62
358 0.53
359 0.48
360 0.44
361 0.36
362 0.28
363 0.19
364 0.13
365 0.12
366 0.12
367 0.15
368 0.16
369 0.18
370 0.21
371 0.22
372 0.23
373 0.24
374 0.27
375 0.23
376 0.25
377 0.25
378 0.28
379 0.28
380 0.29
381 0.31
382 0.3
383 0.3
384 0.35
385 0.36
386 0.35
387 0.4
388 0.4
389 0.4
390 0.46
391 0.5
392 0.49
393 0.53
394 0.51
395 0.46
396 0.46
397 0.46
398 0.45
399 0.42
400 0.38
401 0.32
402 0.32
403 0.31
404 0.3
405 0.26
406 0.18
407 0.18
408 0.16
409 0.14
410 0.11
411 0.1
412 0.09
413 0.1
414 0.1
415 0.1
416 0.1
417 0.11
418 0.11
419 0.12
420 0.13
421 0.13
422 0.14
423 0.13
424 0.12
425 0.12
426 0.11
427 0.11
428 0.08
429 0.07
430 0.06
431 0.08
432 0.08
433 0.09
434 0.1
435 0.11
436 0.11
437 0.13
438 0.14
439 0.13
440 0.13
441 0.15
442 0.14
443 0.14
444 0.16
445 0.14
446 0.13
447 0.12
448 0.12
449 0.12
450 0.16
451 0.17
452 0.18
453 0.19
454 0.2
455 0.21
456 0.21
457 0.2
458 0.18
459 0.19
460 0.17
461 0.17
462 0.17
463 0.17
464 0.16
465 0.16
466 0.14
467 0.12
468 0.12