Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NDX0

Protein Details
Accession G9NDX0    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
23-49KEAAPPSHPPHRQRRTRQKTAVYSKTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSSSTTEKERPNSVEVFGSSSEKEAAPPSHPPHRQRRTRQKTAVYSKTSSKGSTSNSYLAPLDQLPVPGAVGEIANTVGNVPNGAVDRQQPPAKGKSEALKLRLDLNLEIELELKAKIHGSLELTLLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.3
4 0.25
5 0.24
6 0.19
7 0.19
8 0.19
9 0.15
10 0.15
11 0.16
12 0.17
13 0.17
14 0.24
15 0.28
16 0.36
17 0.43
18 0.49
19 0.56
20 0.65
21 0.72
22 0.76
23 0.83
24 0.83
25 0.87
26 0.88
27 0.85
28 0.85
29 0.85
30 0.82
31 0.75
32 0.68
33 0.61
34 0.58
35 0.5
36 0.41
37 0.33
38 0.28
39 0.27
40 0.29
41 0.27
42 0.25
43 0.24
44 0.24
45 0.23
46 0.19
47 0.16
48 0.11
49 0.1
50 0.07
51 0.07
52 0.06
53 0.06
54 0.06
55 0.05
56 0.05
57 0.04
58 0.04
59 0.04
60 0.03
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.05
68 0.05
69 0.06
70 0.07
71 0.07
72 0.08
73 0.1
74 0.12
75 0.18
76 0.2
77 0.22
78 0.25
79 0.3
80 0.32
81 0.32
82 0.33
83 0.34
84 0.41
85 0.44
86 0.43
87 0.41
88 0.39
89 0.39
90 0.38
91 0.33
92 0.25
93 0.22
94 0.21
95 0.18
96 0.17
97 0.15
98 0.13
99 0.12
100 0.11
101 0.09
102 0.08
103 0.08
104 0.09
105 0.1
106 0.12
107 0.14
108 0.16