Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2G6G2

Protein Details
Accession A0A1Y2G6G2    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MASGSFKKSPRGKRGKTKQTAWVSFHydrophilic
NLS Segment(s)
PositionSequence
7-16KKSPRGKRGK
Subcellular Location(s) nucl 22, mito_nucl 13.833, cyto_nucl 11.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MASGSFKKSPRGKRGKTKQTAWVSFMQKRMNEMRDERKHQSLNHKEKMQVIAEEWKTSDDNPKVNPPSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.89
4 0.84
5 0.83
6 0.81
7 0.76
8 0.68
9 0.64
10 0.59
11 0.54
12 0.54
13 0.48
14 0.38
15 0.39
16 0.4
17 0.35
18 0.33
19 0.34
20 0.4
21 0.42
22 0.48
23 0.48
24 0.48
25 0.49
26 0.49
27 0.55
28 0.55
29 0.58
30 0.59
31 0.59
32 0.55
33 0.55
34 0.55
35 0.46
36 0.37
37 0.29
38 0.31
39 0.29
40 0.28
41 0.25
42 0.23
43 0.22
44 0.22
45 0.29
46 0.25
47 0.29
48 0.32
49 0.41