Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FM83

Protein Details
Accession A0A1Y2FM83    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
32-51ARKAKAAKAKARSKIKRTTEHydrophilic
NLS Segment(s)
PositionSequence
32-48ARKAKAAKAKARSKIKR
Subcellular Location(s) nucl 12.5, cyto_nucl 10, mito 7, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF00646  F-box  
Amino Acid Sequences MAGSRRRSTKPSTSYQEVDSDVDMDQEERVEARKAKAAKAKARSKIKRTTEADKVHKDELSPTLEFVLALPLEMLAEVSLPSSFPSERGNIADLLLISRICTHLDPQDLLNLCRTSRVWRTFLLSRRARTVWATVRRREKLPLLSGYSEIKLAVLVFGESCWECAAKRGELDCYFRTRLCAKCRKQLVVAKDRTTSRVMFPSIHRRASECCLSSLFRRDDFFGRFVPSPMSSRSNYCLVPELEASSHRLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.62
3 0.57
4 0.49
5 0.43
6 0.34
7 0.26
8 0.19
9 0.17
10 0.15
11 0.11
12 0.09
13 0.08
14 0.08
15 0.08
16 0.1
17 0.14
18 0.17
19 0.19
20 0.25
21 0.27
22 0.34
23 0.41
24 0.48
25 0.51
26 0.58
27 0.65
28 0.68
29 0.77
30 0.79
31 0.79
32 0.81
33 0.8
34 0.8
35 0.76
36 0.74
37 0.73
38 0.73
39 0.73
40 0.7
41 0.67
42 0.59
43 0.55
44 0.48
45 0.41
46 0.36
47 0.32
48 0.25
49 0.21
50 0.19
51 0.18
52 0.17
53 0.14
54 0.13
55 0.08
56 0.08
57 0.07
58 0.06
59 0.06
60 0.06
61 0.06
62 0.03
63 0.03
64 0.03
65 0.03
66 0.04
67 0.04
68 0.04
69 0.06
70 0.07
71 0.08
72 0.1
73 0.11
74 0.13
75 0.14
76 0.15
77 0.13
78 0.13
79 0.13
80 0.11
81 0.1
82 0.09
83 0.07
84 0.06
85 0.06
86 0.06
87 0.07
88 0.07
89 0.08
90 0.1
91 0.12
92 0.13
93 0.13
94 0.17
95 0.17
96 0.17
97 0.19
98 0.17
99 0.15
100 0.16
101 0.16
102 0.16
103 0.23
104 0.26
105 0.25
106 0.25
107 0.3
108 0.34
109 0.39
110 0.44
111 0.41
112 0.38
113 0.4
114 0.39
115 0.36
116 0.32
117 0.31
118 0.3
119 0.36
120 0.4
121 0.43
122 0.51
123 0.52
124 0.52
125 0.5
126 0.46
127 0.42
128 0.41
129 0.39
130 0.33
131 0.32
132 0.32
133 0.3
134 0.25
135 0.2
136 0.15
137 0.11
138 0.08
139 0.07
140 0.05
141 0.04
142 0.04
143 0.04
144 0.04
145 0.05
146 0.05
147 0.06
148 0.06
149 0.06
150 0.06
151 0.11
152 0.14
153 0.14
154 0.16
155 0.17
156 0.22
157 0.25
158 0.3
159 0.27
160 0.29
161 0.3
162 0.28
163 0.31
164 0.31
165 0.35
166 0.4
167 0.48
168 0.48
169 0.55
170 0.62
171 0.61
172 0.64
173 0.64
174 0.63
175 0.63
176 0.65
177 0.59
178 0.58
179 0.55
180 0.5
181 0.47
182 0.39
183 0.33
184 0.31
185 0.3
186 0.28
187 0.33
188 0.41
189 0.44
190 0.46
191 0.43
192 0.4
193 0.42
194 0.45
195 0.47
196 0.37
197 0.33
198 0.32
199 0.34
200 0.36
201 0.4
202 0.38
203 0.33
204 0.34
205 0.36
206 0.39
207 0.4
208 0.38
209 0.32
210 0.33
211 0.32
212 0.3
213 0.31
214 0.28
215 0.27
216 0.29
217 0.31
218 0.29
219 0.31
220 0.34
221 0.35
222 0.33
223 0.32
224 0.34
225 0.3
226 0.31
227 0.28
228 0.27
229 0.24
230 0.25