Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2D2G3

Protein Details
Accession A0A1Y2D2G3    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
43-67KGSMRQKEIRRLWKKDPTNPNRIEKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito_nucl 12.333, cyto_nucl 10.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010422  Ccdc124/Oxs1  
Pfam View protein in Pfam  
PF06244  Ccdc124  
Amino Acid Sequences MAPSSTKKASDDGKKHRTGGLLAWEEFSKTMTAQLKLEKPNQKGSMRQKEIRRLWKKDPTNPNRIEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.64
3 0.61
4 0.54
5 0.45
6 0.39
7 0.37
8 0.31
9 0.27
10 0.27
11 0.25
12 0.23
13 0.21
14 0.19
15 0.1
16 0.07
17 0.11
18 0.13
19 0.14
20 0.15
21 0.19
22 0.23
23 0.26
24 0.34
25 0.36
26 0.36
27 0.43
28 0.48
29 0.47
30 0.51
31 0.58
32 0.62
33 0.62
34 0.66
35 0.65
36 0.69
37 0.76
38 0.78
39 0.77
40 0.73
41 0.76
42 0.79
43 0.8
44 0.8
45 0.83
46 0.8
47 0.81