Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NE58

Protein Details
Accession G9NE58    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
26-84ITDKERSTARNNKRKRGPQNSRNPTEKKEQVKRRNRVAASKCRQKKREKVNDLKKQSSSHydrophilic
NLS Segment(s)
PositionSequence
34-74ARNNKRKRGPQNSRNPTEKKEQVKRRNRVAASKCRQKKREK
Subcellular Location(s) nucl 24, cyto_nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences MDESPIVSEASPNTCSTHTQPSPSSITDKERSTARNNKRKRGPQNSRNPTEKKEQVKRRNRVAASKCRQKKREKVNDLKKQSSSLKVENSSLHNEYERLRKEIGQVKSDLMHHTECNDSNINQWISNEAKTYVDKLVQKEERQRMGSLSSSNGTVEDVENAQAGLPFGMPSMPSRGNRLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.23
3 0.25
4 0.33
5 0.32
6 0.35
7 0.36
8 0.39
9 0.41
10 0.4
11 0.4
12 0.33
13 0.38
14 0.38
15 0.38
16 0.36
17 0.36
18 0.38
19 0.43
20 0.49
21 0.53
22 0.58
23 0.64
24 0.71
25 0.77
26 0.83
27 0.85
28 0.87
29 0.87
30 0.87
31 0.91
32 0.91
33 0.88
34 0.86
35 0.79
36 0.72
37 0.7
38 0.67
39 0.66
40 0.66
41 0.7
42 0.72
43 0.79
44 0.82
45 0.82
46 0.83
47 0.76
48 0.76
49 0.74
50 0.74
51 0.73
52 0.76
53 0.75
54 0.75
55 0.79
56 0.79
57 0.79
58 0.8
59 0.82
60 0.81
61 0.84
62 0.86
63 0.88
64 0.86
65 0.81
66 0.7
67 0.63
68 0.56
69 0.51
70 0.44
71 0.38
72 0.34
73 0.31
74 0.32
75 0.3
76 0.29
77 0.27
78 0.24
79 0.21
80 0.17
81 0.17
82 0.17
83 0.23
84 0.22
85 0.21
86 0.21
87 0.21
88 0.26
89 0.33
90 0.35
91 0.3
92 0.29
93 0.27
94 0.28
95 0.29
96 0.24
97 0.19
98 0.17
99 0.14
100 0.15
101 0.17
102 0.15
103 0.18
104 0.18
105 0.16
106 0.16
107 0.22
108 0.21
109 0.19
110 0.19
111 0.19
112 0.19
113 0.2
114 0.19
115 0.14
116 0.15
117 0.15
118 0.18
119 0.16
120 0.19
121 0.22
122 0.23
123 0.32
124 0.36
125 0.4
126 0.47
127 0.53
128 0.55
129 0.54
130 0.52
131 0.44
132 0.42
133 0.4
134 0.32
135 0.27
136 0.21
137 0.19
138 0.19
139 0.17
140 0.14
141 0.12
142 0.11
143 0.1
144 0.1
145 0.1
146 0.1
147 0.1
148 0.09
149 0.09
150 0.09
151 0.07
152 0.07
153 0.06
154 0.06
155 0.07
156 0.07
157 0.09
158 0.15
159 0.21
160 0.22