Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2C155

Protein Details
Accession A0A1Y2C155    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-36SASAARPRPHILKRRNPTYSPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, E.R. 6, cyto 3, plas 2, golg 2, cyto_mito 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR037457  M28_QC  
IPR007484  Peptidase_M28  
IPR040234  QC/QCL  
Gene Ontology GO:0016603  F:glutaminyl-peptide cyclotransferase activity  
GO:0046872  F:metal ion binding  
GO:0008233  F:peptidase activity  
GO:0017186  P:peptidyl-pyroglutamic acid biosynthetic process, using glutaminyl-peptide cyclotransferase  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF04389  Peptidase_M28  
CDD cd03880  M28_QC_like  
Amino Acid Sequences MLLLPPLLLLLSVTLSASAARPRPHILKRRNPTYSPLSSSSLDALVNLTNLDTILDFNDPKSALSKLLVPRAAGSTNLTRLQDMVVDHFTALKWHVEKDHFEEETPYGVKPFTNLIFTHDPDATRRLVLSAHLDSKFFPSHPEDQFVGATDSAAPCAMLLDVATALTDWLDARKERIVSRGGEEGRETQGETLQIVFFDGEEAFKEWTSTDSVYGARHLAELWSKPTVPPTATIPVPPSPLSRISHLVLLDLLGAPNPVIRSFYKNTGWFFDEFMHSEDRLGSAGFLWPGLEGDEYAATKEKVGVRERSFFVPRGGYSGFAGTVGDDHEPFLHKGVPVVHMITVPFPHVWHTIKDDVSVLDLPTIKAWTLLIRLTIAEYLGLDPELAPTEADLMRDDTARRRTEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.09
5 0.14
6 0.19
7 0.21
8 0.25
9 0.31
10 0.4
11 0.49
12 0.57
13 0.62
14 0.68
15 0.75
16 0.83
17 0.84
18 0.78
19 0.76
20 0.74
21 0.7
22 0.66
23 0.6
24 0.53
25 0.47
26 0.45
27 0.4
28 0.32
29 0.25
30 0.19
31 0.16
32 0.12
33 0.12
34 0.1
35 0.08
36 0.07
37 0.07
38 0.07
39 0.06
40 0.06
41 0.07
42 0.1
43 0.1
44 0.1
45 0.14
46 0.14
47 0.14
48 0.16
49 0.16
50 0.14
51 0.15
52 0.22
53 0.23
54 0.3
55 0.31
56 0.29
57 0.3
58 0.31
59 0.31
60 0.25
61 0.24
62 0.21
63 0.24
64 0.27
65 0.26
66 0.23
67 0.23
68 0.22
69 0.21
70 0.17
71 0.17
72 0.15
73 0.15
74 0.14
75 0.15
76 0.14
77 0.13
78 0.13
79 0.14
80 0.13
81 0.15
82 0.2
83 0.23
84 0.26
85 0.31
86 0.37
87 0.33
88 0.32
89 0.33
90 0.29
91 0.29
92 0.27
93 0.21
94 0.14
95 0.14
96 0.13
97 0.12
98 0.15
99 0.13
100 0.15
101 0.15
102 0.2
103 0.24
104 0.25
105 0.27
106 0.24
107 0.24
108 0.23
109 0.25
110 0.2
111 0.16
112 0.15
113 0.13
114 0.12
115 0.13
116 0.16
117 0.16
118 0.21
119 0.21
120 0.21
121 0.21
122 0.24
123 0.24
124 0.19
125 0.19
126 0.19
127 0.26
128 0.27
129 0.3
130 0.27
131 0.27
132 0.27
133 0.25
134 0.21
135 0.14
136 0.13
137 0.1
138 0.09
139 0.07
140 0.07
141 0.06
142 0.04
143 0.04
144 0.04
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.04
157 0.06
158 0.06
159 0.08
160 0.11
161 0.13
162 0.14
163 0.18
164 0.2
165 0.19
166 0.22
167 0.26
168 0.24
169 0.23
170 0.23
171 0.21
172 0.19
173 0.18
174 0.16
175 0.1
176 0.11
177 0.1
178 0.09
179 0.08
180 0.07
181 0.06
182 0.06
183 0.06
184 0.04
185 0.05
186 0.05
187 0.04
188 0.04
189 0.06
190 0.06
191 0.06
192 0.06
193 0.06
194 0.07
195 0.08
196 0.08
197 0.08
198 0.08
199 0.09
200 0.09
201 0.1
202 0.09
203 0.08
204 0.08
205 0.07
206 0.07
207 0.08
208 0.09
209 0.11
210 0.11
211 0.12
212 0.12
213 0.14
214 0.15
215 0.13
216 0.14
217 0.15
218 0.18
219 0.18
220 0.18
221 0.19
222 0.18
223 0.2
224 0.2
225 0.17
226 0.16
227 0.2
228 0.21
229 0.21
230 0.22
231 0.21
232 0.23
233 0.22
234 0.19
235 0.15
236 0.13
237 0.11
238 0.08
239 0.07
240 0.04
241 0.04
242 0.04
243 0.05
244 0.05
245 0.05
246 0.08
247 0.09
248 0.15
249 0.18
250 0.23
251 0.28
252 0.31
253 0.32
254 0.33
255 0.35
256 0.29
257 0.28
258 0.24
259 0.21
260 0.19
261 0.19
262 0.18
263 0.16
264 0.16
265 0.14
266 0.13
267 0.11
268 0.1
269 0.08
270 0.06
271 0.07
272 0.07
273 0.07
274 0.06
275 0.06
276 0.06
277 0.07
278 0.06
279 0.05
280 0.06
281 0.07
282 0.07
283 0.08
284 0.1
285 0.09
286 0.09
287 0.14
288 0.17
289 0.21
290 0.27
291 0.34
292 0.36
293 0.42
294 0.44
295 0.46
296 0.46
297 0.42
298 0.39
299 0.35
300 0.31
301 0.3
302 0.27
303 0.23
304 0.2
305 0.19
306 0.16
307 0.13
308 0.12
309 0.08
310 0.08
311 0.08
312 0.08
313 0.07
314 0.08
315 0.09
316 0.12
317 0.13
318 0.14
319 0.15
320 0.14
321 0.16
322 0.18
323 0.19
324 0.18
325 0.19
326 0.18
327 0.16
328 0.17
329 0.16
330 0.15
331 0.14
332 0.13
333 0.12
334 0.15
335 0.19
336 0.2
337 0.21
338 0.27
339 0.3
340 0.3
341 0.31
342 0.29
343 0.24
344 0.25
345 0.24
346 0.18
347 0.16
348 0.17
349 0.16
350 0.16
351 0.17
352 0.13
353 0.13
354 0.13
355 0.12
356 0.14
357 0.15
358 0.15
359 0.14
360 0.15
361 0.16
362 0.16
363 0.13
364 0.11
365 0.1
366 0.1
367 0.1
368 0.09
369 0.08
370 0.07
371 0.09
372 0.11
373 0.1
374 0.09
375 0.09
376 0.13
377 0.13
378 0.14
379 0.15
380 0.15
381 0.16
382 0.18
383 0.21
384 0.25
385 0.32