Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2MC50

Protein Details
Accession A0A1Y2MC50    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
68-94RVQARAPNRKGNRQYKRRNNHMGTPNLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, nucl 6, mito 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MCFFLAVLECIFRSILRLKRTAYALAAPYAHFDLDNNEVCRLLSLEIRAIYSSAVLQYLTLRPQSYSRVQARAPNRKGNRQYKRRNNHMGTPNLHRTTLHRSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.24
3 0.27
4 0.31
5 0.32
6 0.37
7 0.39
8 0.38
9 0.33
10 0.3
11 0.27
12 0.25
13 0.24
14 0.19
15 0.18
16 0.17
17 0.15
18 0.11
19 0.09
20 0.1
21 0.14
22 0.18
23 0.17
24 0.17
25 0.17
26 0.17
27 0.17
28 0.15
29 0.11
30 0.08
31 0.08
32 0.09
33 0.1
34 0.1
35 0.1
36 0.09
37 0.08
38 0.07
39 0.06
40 0.05
41 0.04
42 0.04
43 0.04
44 0.05
45 0.07
46 0.08
47 0.09
48 0.09
49 0.1
50 0.12
51 0.16
52 0.19
53 0.26
54 0.29
55 0.31
56 0.32
57 0.39
58 0.47
59 0.53
60 0.55
61 0.57
62 0.59
63 0.65
64 0.73
65 0.77
66 0.78
67 0.79
68 0.84
69 0.85
70 0.9
71 0.9
72 0.91
73 0.86
74 0.85
75 0.83
76 0.8
77 0.74
78 0.72
79 0.72
80 0.63
81 0.58
82 0.49
83 0.45