Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NRM9

Protein Details
Accession G9NRM9    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
125-153QKDAEQQATNRKPKKKAKKIKLSFDEEEGHydrophilic
NLS Segment(s)
PositionSequence
134-145NRKPKKKAKKIK
Subcellular Location(s) nucl 17, mito_nucl 13.333, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSQKINSKNLSYNSSLPPFLAALRAQTSGASGPDPILSAQRRGAKKRSSSEEAEDAPLVVDEEGNAVDDLKTAQSKTNKSDLETAKASIGGRKRKVGKVIGENAENSEPETSAADKKSEPVKKDQKDAEQQATNRKPKKKAKKIKLSFDEEEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.41
3 0.34
4 0.31
5 0.26
6 0.22
7 0.2
8 0.14
9 0.14
10 0.16
11 0.17
12 0.15
13 0.15
14 0.15
15 0.14
16 0.14
17 0.11
18 0.09
19 0.09
20 0.09
21 0.1
22 0.09
23 0.14
24 0.14
25 0.16
26 0.21
27 0.28
28 0.33
29 0.38
30 0.45
31 0.46
32 0.52
33 0.58
34 0.61
35 0.59
36 0.57
37 0.56
38 0.53
39 0.47
40 0.41
41 0.33
42 0.25
43 0.19
44 0.16
45 0.11
46 0.07
47 0.05
48 0.03
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.05
57 0.05
58 0.06
59 0.06
60 0.1
61 0.15
62 0.17
63 0.21
64 0.27
65 0.27
66 0.28
67 0.35
68 0.33
69 0.32
70 0.31
71 0.28
72 0.22
73 0.23
74 0.21
75 0.17
76 0.22
77 0.25
78 0.27
79 0.32
80 0.37
81 0.39
82 0.45
83 0.47
84 0.47
85 0.47
86 0.52
87 0.48
88 0.45
89 0.41
90 0.38
91 0.33
92 0.27
93 0.2
94 0.13
95 0.1
96 0.09
97 0.11
98 0.1
99 0.13
100 0.14
101 0.15
102 0.15
103 0.19
104 0.27
105 0.31
106 0.33
107 0.4
108 0.49
109 0.52
110 0.6
111 0.63
112 0.62
113 0.67
114 0.7
115 0.68
116 0.64
117 0.62
118 0.65
119 0.68
120 0.69
121 0.67
122 0.68
123 0.71
124 0.75
125 0.83
126 0.84
127 0.86
128 0.88
129 0.91
130 0.93
131 0.94
132 0.93
133 0.9