Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NP09

Protein Details
Accession G9NP09    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
331-355ASKVPGLRRWVEKKRTKTEVNEFEIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 22, E.R. 2, mito 1, extr 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR004923  FTR1/Fip1/EfeU  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0033573  C:high-affinity iron permease complex  
GO:0005381  F:iron ion transmembrane transporter activity  
Pfam View protein in Pfam  
PF03239  FTR1  
Amino Acid Sequences MAKNVFAVQIFFIVFRECLEAVIIISVLLSFLKQCLGGPGQDQAIYKRLVRQVWLGSAAGIVICLIIGGGFIGAFYGLGKDIWSKSEDLWEGIFYLIAAIIVSIMGLALLRINKMKDKWRVKIAQALAEKSADAEKPRNWLSDWSRRHVMFILPFITTLREGVEAVVFVGGVSLSLPATAFPLPVVCGIIAGLAVGFFIYRGGNLMSIQLFLIASTSVLYLIAAGMFSKAVWSLQYHTFAQRVGSDVAEAGNGPGSYNILETVWHVNCCNPETDNGWDVFNSILGWQNTGTYGSVIAYNIYWLFLILTVTLLMYEEKTGSLPLKNEFLSAASKVPGLRRWVEKKRTKTEVNEFEIFQQVQAAGLLRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.15
4 0.13
5 0.13
6 0.14
7 0.13
8 0.11
9 0.12
10 0.11
11 0.07
12 0.06
13 0.06
14 0.05
15 0.05
16 0.05
17 0.04
18 0.05
19 0.06
20 0.07
21 0.07
22 0.12
23 0.14
24 0.15
25 0.16
26 0.19
27 0.19
28 0.22
29 0.23
30 0.2
31 0.23
32 0.23
33 0.23
34 0.27
35 0.31
36 0.3
37 0.31
38 0.34
39 0.34
40 0.35
41 0.36
42 0.29
43 0.24
44 0.22
45 0.19
46 0.13
47 0.09
48 0.06
49 0.03
50 0.03
51 0.03
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.03
62 0.03
63 0.03
64 0.04
65 0.04
66 0.05
67 0.08
68 0.09
69 0.11
70 0.12
71 0.13
72 0.13
73 0.19
74 0.2
75 0.18
76 0.18
77 0.17
78 0.16
79 0.14
80 0.14
81 0.07
82 0.06
83 0.05
84 0.04
85 0.04
86 0.03
87 0.03
88 0.03
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.04
96 0.04
97 0.06
98 0.08
99 0.09
100 0.14
101 0.18
102 0.26
103 0.35
104 0.43
105 0.47
106 0.54
107 0.58
108 0.56
109 0.61
110 0.55
111 0.52
112 0.47
113 0.43
114 0.35
115 0.3
116 0.27
117 0.2
118 0.2
119 0.13
120 0.13
121 0.16
122 0.16
123 0.21
124 0.23
125 0.24
126 0.23
127 0.29
128 0.33
129 0.39
130 0.42
131 0.42
132 0.46
133 0.44
134 0.45
135 0.39
136 0.35
137 0.26
138 0.25
139 0.21
140 0.16
141 0.16
142 0.15
143 0.14
144 0.11
145 0.09
146 0.08
147 0.07
148 0.07
149 0.07
150 0.07
151 0.05
152 0.05
153 0.05
154 0.04
155 0.03
156 0.03
157 0.02
158 0.02
159 0.02
160 0.03
161 0.02
162 0.03
163 0.03
164 0.03
165 0.05
166 0.05
167 0.05
168 0.04
169 0.05
170 0.05
171 0.06
172 0.06
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.03
179 0.02
180 0.02
181 0.02
182 0.02
183 0.02
184 0.02
185 0.02
186 0.03
187 0.03
188 0.04
189 0.04
190 0.05
191 0.05
192 0.06
193 0.06
194 0.06
195 0.06
196 0.06
197 0.05
198 0.05
199 0.05
200 0.04
201 0.04
202 0.04
203 0.04
204 0.03
205 0.04
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.04
218 0.05
219 0.06
220 0.09
221 0.12
222 0.16
223 0.17
224 0.19
225 0.19
226 0.19
227 0.19
228 0.16
229 0.16
230 0.13
231 0.12
232 0.1
233 0.1
234 0.09
235 0.08
236 0.08
237 0.05
238 0.06
239 0.06
240 0.06
241 0.05
242 0.06
243 0.06
244 0.06
245 0.07
246 0.05
247 0.06
248 0.07
249 0.13
250 0.14
251 0.14
252 0.15
253 0.16
254 0.19
255 0.2
256 0.2
257 0.15
258 0.16
259 0.18
260 0.22
261 0.22
262 0.21
263 0.2
264 0.18
265 0.18
266 0.16
267 0.13
268 0.09
269 0.07
270 0.12
271 0.12
272 0.13
273 0.12
274 0.13
275 0.13
276 0.14
277 0.14
278 0.08
279 0.08
280 0.08
281 0.09
282 0.08
283 0.08
284 0.07
285 0.08
286 0.08
287 0.08
288 0.07
289 0.06
290 0.06
291 0.06
292 0.07
293 0.06
294 0.06
295 0.06
296 0.06
297 0.06
298 0.06
299 0.06
300 0.06
301 0.07
302 0.07
303 0.07
304 0.08
305 0.1
306 0.12
307 0.14
308 0.16
309 0.18
310 0.22
311 0.22
312 0.22
313 0.21
314 0.21
315 0.2
316 0.2
317 0.19
318 0.15
319 0.17
320 0.19
321 0.22
322 0.25
323 0.28
324 0.32
325 0.4
326 0.49
327 0.58
328 0.67
329 0.72
330 0.77
331 0.81
332 0.84
333 0.82
334 0.82
335 0.82
336 0.81
337 0.79
338 0.72
339 0.64
340 0.57
341 0.56
342 0.46
343 0.35
344 0.27
345 0.2
346 0.17
347 0.17