Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2LN85

Protein Details
Accession A0A1Y2LN85    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MSGSERDSPPRKRPRTKAPPRVAPAAPHydrophilic
NLS Segment(s)
PositionSequence
9-22PPRKRPRTKAPPRV
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039039  RAI1-like_fam  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0004518  F:nuclease activity  
GO:0000166  F:nucleotide binding  
GO:0003723  F:RNA binding  
GO:0016070  P:RNA metabolic process  
Amino Acid Sequences MSGSERDSPPRKRPRTKAPPRVAPAAPAAPAAPAPTPVTNTSDSTPQSVPPHTPAAMPQPPLSQPSETHRFSIQPLSRFQGASASIKRPREVAHFSYDDNHSYRDDDSSINYYVPPPIGADLKEGFETFRHYEDKEDPHLDSLLRAVMHKESAAAESGAEIKADFVTWRGMMTKVRGRQTAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.91
4 0.92
5 0.91
6 0.91
7 0.86
8 0.84
9 0.73
10 0.64
11 0.58
12 0.49
13 0.39
14 0.29
15 0.24
16 0.17
17 0.17
18 0.15
19 0.11
20 0.1
21 0.12
22 0.13
23 0.15
24 0.16
25 0.2
26 0.2
27 0.22
28 0.22
29 0.24
30 0.24
31 0.25
32 0.24
33 0.24
34 0.25
35 0.25
36 0.25
37 0.24
38 0.26
39 0.23
40 0.23
41 0.21
42 0.26
43 0.27
44 0.27
45 0.25
46 0.24
47 0.24
48 0.26
49 0.27
50 0.2
51 0.18
52 0.23
53 0.3
54 0.28
55 0.29
56 0.27
57 0.26
58 0.26
59 0.33
60 0.3
61 0.26
62 0.27
63 0.29
64 0.29
65 0.28
66 0.26
67 0.2
68 0.18
69 0.19
70 0.2
71 0.22
72 0.25
73 0.26
74 0.27
75 0.24
76 0.24
77 0.25
78 0.28
79 0.26
80 0.26
81 0.26
82 0.26
83 0.28
84 0.28
85 0.24
86 0.2
87 0.19
88 0.14
89 0.14
90 0.14
91 0.13
92 0.12
93 0.11
94 0.12
95 0.14
96 0.14
97 0.13
98 0.13
99 0.12
100 0.12
101 0.11
102 0.1
103 0.07
104 0.08
105 0.09
106 0.09
107 0.11
108 0.12
109 0.13
110 0.13
111 0.13
112 0.12
113 0.11
114 0.15
115 0.14
116 0.16
117 0.17
118 0.17
119 0.21
120 0.26
121 0.3
122 0.31
123 0.32
124 0.3
125 0.29
126 0.3
127 0.26
128 0.21
129 0.17
130 0.14
131 0.12
132 0.12
133 0.11
134 0.12
135 0.13
136 0.12
137 0.12
138 0.11
139 0.12
140 0.13
141 0.11
142 0.1
143 0.09
144 0.11
145 0.1
146 0.09
147 0.08
148 0.07
149 0.07
150 0.08
151 0.08
152 0.07
153 0.1
154 0.1
155 0.12
156 0.13
157 0.15
158 0.18
159 0.25
160 0.33
161 0.37
162 0.43