Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2M3G9

Protein Details
Accession A0A1Y2M3G9   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MLNLKRVIDKRRKKRELKRIYKQACSKKLAHydrophilic
NLS Segment(s)
PositionSequence
9-22DKRRKKRELKRIYK
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MLNLKRVIDKRRKKRELKRIYKQACSKKLAKQRELSNREVSPRLLLPGEIRNGIYSYLIAGHDLDIHTGFRSQKSIRVDLPHEFRALPQVSRQISNEVISYVAQHNNFSIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.93
3 0.93
4 0.93
5 0.93
6 0.93
7 0.89
8 0.88
9 0.87
10 0.86
11 0.82
12 0.77
13 0.72
14 0.69
15 0.72
16 0.72
17 0.7
18 0.66
19 0.68
20 0.72
21 0.72
22 0.68
23 0.65
24 0.57
25 0.54
26 0.49
27 0.4
28 0.31
29 0.26
30 0.23
31 0.16
32 0.15
33 0.13
34 0.15
35 0.16
36 0.14
37 0.14
38 0.13
39 0.13
40 0.12
41 0.1
42 0.07
43 0.05
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.09
56 0.09
57 0.09
58 0.14
59 0.14
60 0.19
61 0.24
62 0.27
63 0.28
64 0.32
65 0.34
66 0.36
67 0.41
68 0.38
69 0.34
70 0.31
71 0.28
72 0.31
73 0.29
74 0.24
75 0.22
76 0.28
77 0.29
78 0.31
79 0.33
80 0.29
81 0.29
82 0.29
83 0.26
84 0.19
85 0.18
86 0.15
87 0.16
88 0.16
89 0.19
90 0.19
91 0.19