Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2LUG4

Protein Details
Accession A0A1Y2LUG4    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
78-99IDLGKKKLKKELKKQGLIQRSIHydrophilic
NLS Segment(s)
PositionSequence
81-91GKKKLKKELKK
Subcellular Location(s) cyto 15.5, cyto_nucl 11, mito 6, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MGIINGNIKLELSNVGTLTNQPKIDLVPMWNAFLAQHFTKAENWGVTVVAAVEKKIVTLKNSRKGKTSAQKDVITREIDLGKKKLKKELKKQGLIQRSIHELYLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.16
5 0.18
6 0.21
7 0.19
8 0.18
9 0.18
10 0.18
11 0.2
12 0.18
13 0.16
14 0.18
15 0.19
16 0.19
17 0.19
18 0.18
19 0.16
20 0.16
21 0.17
22 0.11
23 0.13
24 0.13
25 0.14
26 0.15
27 0.17
28 0.17
29 0.14
30 0.14
31 0.12
32 0.11
33 0.09
34 0.08
35 0.06
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.06
42 0.08
43 0.09
44 0.1
45 0.19
46 0.27
47 0.36
48 0.43
49 0.44
50 0.46
51 0.49
52 0.56
53 0.57
54 0.57
55 0.57
56 0.56
57 0.59
58 0.56
59 0.57
60 0.52
61 0.43
62 0.35
63 0.29
64 0.27
65 0.26
66 0.29
67 0.3
68 0.34
69 0.38
70 0.4
71 0.47
72 0.54
73 0.61
74 0.67
75 0.74
76 0.76
77 0.79
78 0.85
79 0.85
80 0.85
81 0.8
82 0.72
83 0.64
84 0.6
85 0.53