Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2LT09

Protein Details
Accession A0A1Y2LT09   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-26ASLYAHQTRKRRCPPSSPPCTSPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045038  AIG2-like  
IPR009288  AIG2-like_dom  
IPR013024  GGCT-like  
IPR036568  GGCT-like_sf  
Pfam View protein in Pfam  
PF06094  GGACT  
CDD cd06661  GGCT_like  
Amino Acid Sequences MDLASLYAHQTRKRRCPPSSPPCTSPSTNPYPSTTMSHTAFFYGTLMAPPVLHRVIWGTASPPTPAHASLLAIRPAILHGHVRRRVKGADYPAVTPSSAESEVRGTLVAGLTDGDVWRLDIFEGSEYERRHVRVRVWGEEGKGGKGEVEAQTYVWVAGEQRLEPQEWDFDHFVKEKMGRWVGEEAEDEGFKDVDDAVDAMQDPTGGRGLNGDIARQLETGGKEAEKALGSAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.72
3 0.78
4 0.82
5 0.85
6 0.86
7 0.82
8 0.76
9 0.71
10 0.71
11 0.63
12 0.59
13 0.56
14 0.53
15 0.51
16 0.49
17 0.49
18 0.46
19 0.45
20 0.43
21 0.39
22 0.36
23 0.33
24 0.32
25 0.29
26 0.26
27 0.24
28 0.2
29 0.16
30 0.11
31 0.1
32 0.08
33 0.09
34 0.08
35 0.08
36 0.09
37 0.12
38 0.11
39 0.11
40 0.11
41 0.12
42 0.13
43 0.14
44 0.13
45 0.11
46 0.14
47 0.15
48 0.16
49 0.14
50 0.14
51 0.15
52 0.15
53 0.15
54 0.12
55 0.13
56 0.15
57 0.18
58 0.17
59 0.16
60 0.15
61 0.14
62 0.14
63 0.13
64 0.11
65 0.13
66 0.16
67 0.25
68 0.32
69 0.35
70 0.36
71 0.39
72 0.39
73 0.37
74 0.38
75 0.35
76 0.36
77 0.34
78 0.34
79 0.32
80 0.31
81 0.27
82 0.22
83 0.16
84 0.12
85 0.12
86 0.1
87 0.09
88 0.1
89 0.1
90 0.1
91 0.09
92 0.06
93 0.06
94 0.06
95 0.05
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.05
110 0.05
111 0.07
112 0.12
113 0.12
114 0.14
115 0.16
116 0.17
117 0.2
118 0.22
119 0.22
120 0.26
121 0.3
122 0.32
123 0.36
124 0.36
125 0.33
126 0.35
127 0.33
128 0.25
129 0.21
130 0.18
131 0.12
132 0.11
133 0.13
134 0.1
135 0.11
136 0.1
137 0.1
138 0.11
139 0.11
140 0.11
141 0.08
142 0.07
143 0.05
144 0.08
145 0.09
146 0.08
147 0.11
148 0.12
149 0.13
150 0.13
151 0.14
152 0.15
153 0.15
154 0.19
155 0.18
156 0.17
157 0.2
158 0.2
159 0.2
160 0.2
161 0.21
162 0.2
163 0.26
164 0.29
165 0.27
166 0.28
167 0.31
168 0.27
169 0.28
170 0.25
171 0.2
172 0.18
173 0.17
174 0.15
175 0.13
176 0.12
177 0.1
178 0.09
179 0.08
180 0.06
181 0.07
182 0.06
183 0.05
184 0.06
185 0.07
186 0.07
187 0.07
188 0.07
189 0.06
190 0.07
191 0.09
192 0.08
193 0.07
194 0.09
195 0.1
196 0.16
197 0.16
198 0.15
199 0.16
200 0.17
201 0.19
202 0.17
203 0.17
204 0.15
205 0.16
206 0.18
207 0.19
208 0.18
209 0.17
210 0.18
211 0.2
212 0.17