Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2M1U6

Protein Details
Accession A0A1Y2M1U6   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
179-209VDLPERPKTPPRKRPTRRPTQKAKKWTFDKTBasic
NLS Segment(s)
PositionSequence
184-203RPKTPPRKRPTRRPTQKAKK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024758  Inp1  
Gene Ontology GO:0005780  C:extrinsic component of intraperoxisomal membrane  
GO:0045033  P:peroxisome inheritance  
Pfam View protein in Pfam  
PF12634  Inp1  
Amino Acid Sequences MSSPLAPSRTSEQAPPPLHSSRRSFTVPARLRSSPAPAPASTSIADGIETLVVCPHSKIVSFAAAGTSAAGAGNQIAWTTPTERTLAVGVLRIYRVTASNVSFLNSGNLLHTIFPRSQCWCVDGQSVFVLRIRQDSYYRMELPFETDDDKAKIEQFKTVLSQVLQYEKTQCPFRQNVEVDLPERPKTPPRKRPTRRPTQKAKKWTFDKTWMPEDGSRPSTPVREGLDSANTSSYEEDDQSSVHTDTSDLPVPETPNTIFEDTPPPKAVRRLSVAERAQLFQSPRSVTAPLSIARDRSFSSASSMGCIPEMSKEEEKRSPQDSIARPAPIERKPSSDAASLLSGSSSFYSLETARRSPSPPFLDAEAEILDPWVDSLPAQNDVRGRARHRRDASEMTVRAVSTDYASKSSAVTPVVPLQPITTPSIALRPSSAPHTPPLVSDSDEDSLGQPSLDVPTPPNMIRMRKLTGASPRRAFSPMPHPQNLNFPTRQKPDQKFTAALVRKTYEIVLGPPQHLVSLMLRIAASISNGFGFSTYRVRRTKSIPGAWESSGEEDEWEEDDFGIPLSNLGEPVRRTGQPGELD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.49
4 0.5
5 0.53
6 0.54
7 0.54
8 0.48
9 0.51
10 0.52
11 0.5
12 0.49
13 0.56
14 0.57
15 0.57
16 0.59
17 0.55
18 0.54
19 0.53
20 0.54
21 0.48
22 0.46
23 0.43
24 0.37
25 0.41
26 0.4
27 0.39
28 0.32
29 0.28
30 0.23
31 0.18
32 0.18
33 0.13
34 0.11
35 0.09
36 0.09
37 0.08
38 0.09
39 0.1
40 0.1
41 0.11
42 0.12
43 0.12
44 0.13
45 0.15
46 0.15
47 0.18
48 0.18
49 0.17
50 0.16
51 0.15
52 0.15
53 0.13
54 0.1
55 0.07
56 0.06
57 0.06
58 0.05
59 0.04
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.09
66 0.12
67 0.13
68 0.14
69 0.16
70 0.16
71 0.17
72 0.17
73 0.17
74 0.14
75 0.16
76 0.15
77 0.16
78 0.16
79 0.15
80 0.14
81 0.14
82 0.14
83 0.15
84 0.18
85 0.17
86 0.2
87 0.2
88 0.21
89 0.21
90 0.19
91 0.18
92 0.15
93 0.13
94 0.11
95 0.12
96 0.11
97 0.12
98 0.13
99 0.14
100 0.17
101 0.19
102 0.21
103 0.24
104 0.27
105 0.26
106 0.27
107 0.26
108 0.26
109 0.29
110 0.26
111 0.23
112 0.23
113 0.23
114 0.21
115 0.2
116 0.2
117 0.15
118 0.19
119 0.19
120 0.19
121 0.2
122 0.23
123 0.27
124 0.3
125 0.32
126 0.28
127 0.28
128 0.26
129 0.28
130 0.26
131 0.22
132 0.19
133 0.17
134 0.19
135 0.19
136 0.2
137 0.16
138 0.19
139 0.22
140 0.21
141 0.24
142 0.22
143 0.23
144 0.24
145 0.24
146 0.23
147 0.18
148 0.2
149 0.18
150 0.22
151 0.21
152 0.2
153 0.24
154 0.24
155 0.28
156 0.31
157 0.31
158 0.33
159 0.36
160 0.39
161 0.42
162 0.41
163 0.41
164 0.4
165 0.41
166 0.35
167 0.36
168 0.35
169 0.27
170 0.27
171 0.25
172 0.29
173 0.38
174 0.47
175 0.53
176 0.6
177 0.7
178 0.78
179 0.87
180 0.89
181 0.9
182 0.9
183 0.9
184 0.91
185 0.91
186 0.91
187 0.9
188 0.88
189 0.86
190 0.81
191 0.8
192 0.74
193 0.71
194 0.69
195 0.64
196 0.6
197 0.52
198 0.48
199 0.43
200 0.41
201 0.37
202 0.33
203 0.28
204 0.25
205 0.25
206 0.24
207 0.22
208 0.23
209 0.2
210 0.18
211 0.19
212 0.19
213 0.21
214 0.2
215 0.2
216 0.17
217 0.14
218 0.13
219 0.12
220 0.12
221 0.09
222 0.09
223 0.09
224 0.08
225 0.08
226 0.08
227 0.11
228 0.1
229 0.09
230 0.08
231 0.08
232 0.09
233 0.12
234 0.14
235 0.12
236 0.12
237 0.14
238 0.15
239 0.14
240 0.15
241 0.12
242 0.11
243 0.14
244 0.14
245 0.13
246 0.13
247 0.22
248 0.22
249 0.24
250 0.24
251 0.23
252 0.23
253 0.28
254 0.29
255 0.23
256 0.26
257 0.28
258 0.29
259 0.37
260 0.36
261 0.35
262 0.33
263 0.3
264 0.26
265 0.25
266 0.23
267 0.16
268 0.18
269 0.16
270 0.16
271 0.16
272 0.17
273 0.14
274 0.15
275 0.15
276 0.13
277 0.16
278 0.16
279 0.15
280 0.15
281 0.16
282 0.15
283 0.15
284 0.15
285 0.12
286 0.14
287 0.15
288 0.15
289 0.15
290 0.14
291 0.12
292 0.11
293 0.11
294 0.08
295 0.08
296 0.1
297 0.12
298 0.16
299 0.18
300 0.22
301 0.26
302 0.29
303 0.31
304 0.32
305 0.29
306 0.27
307 0.34
308 0.32
309 0.34
310 0.35
311 0.31
312 0.29
313 0.3
314 0.34
315 0.3
316 0.33
317 0.28
318 0.29
319 0.32
320 0.34
321 0.33
322 0.29
323 0.26
324 0.21
325 0.21
326 0.16
327 0.13
328 0.11
329 0.08
330 0.07
331 0.07
332 0.06
333 0.05
334 0.05
335 0.07
336 0.08
337 0.11
338 0.14
339 0.15
340 0.16
341 0.18
342 0.2
343 0.21
344 0.28
345 0.28
346 0.27
347 0.27
348 0.27
349 0.27
350 0.25
351 0.24
352 0.16
353 0.12
354 0.11
355 0.09
356 0.07
357 0.05
358 0.05
359 0.04
360 0.03
361 0.03
362 0.06
363 0.07
364 0.12
365 0.12
366 0.14
367 0.15
368 0.19
369 0.24
370 0.26
371 0.3
372 0.36
373 0.43
374 0.51
375 0.54
376 0.55
377 0.56
378 0.57
379 0.58
380 0.57
381 0.51
382 0.43
383 0.4
384 0.34
385 0.28
386 0.23
387 0.18
388 0.1
389 0.13
390 0.12
391 0.13
392 0.14
393 0.14
394 0.14
395 0.15
396 0.16
397 0.13
398 0.13
399 0.13
400 0.17
401 0.18
402 0.17
403 0.16
404 0.15
405 0.16
406 0.17
407 0.18
408 0.14
409 0.13
410 0.14
411 0.18
412 0.18
413 0.16
414 0.16
415 0.15
416 0.16
417 0.2
418 0.22
419 0.19
420 0.21
421 0.25
422 0.23
423 0.22
424 0.24
425 0.2
426 0.19
427 0.19
428 0.2
429 0.17
430 0.17
431 0.17
432 0.15
433 0.14
434 0.13
435 0.11
436 0.08
437 0.07
438 0.1
439 0.1
440 0.1
441 0.1
442 0.14
443 0.18
444 0.18
445 0.24
446 0.26
447 0.29
448 0.34
449 0.37
450 0.37
451 0.38
452 0.39
453 0.38
454 0.44
455 0.48
456 0.51
457 0.51
458 0.48
459 0.46
460 0.48
461 0.43
462 0.38
463 0.41
464 0.43
465 0.46
466 0.48
467 0.48
468 0.47
469 0.56
470 0.54
471 0.5
472 0.46
473 0.43
474 0.49
475 0.53
476 0.59
477 0.59
478 0.63
479 0.64
480 0.67
481 0.67
482 0.6
483 0.57
484 0.59
485 0.55
486 0.5
487 0.47
488 0.41
489 0.36
490 0.35
491 0.33
492 0.25
493 0.2
494 0.2
495 0.23
496 0.24
497 0.24
498 0.25
499 0.24
500 0.22
501 0.21
502 0.2
503 0.14
504 0.15
505 0.14
506 0.14
507 0.14
508 0.14
509 0.14
510 0.12
511 0.12
512 0.09
513 0.09
514 0.09
515 0.09
516 0.09
517 0.09
518 0.09
519 0.11
520 0.2
521 0.24
522 0.31
523 0.36
524 0.41
525 0.46
526 0.51
527 0.59
528 0.6
529 0.63
530 0.61
531 0.62
532 0.62
533 0.57
534 0.53
535 0.44
536 0.37
537 0.3
538 0.24
539 0.19
540 0.15
541 0.16
542 0.14
543 0.14
544 0.11
545 0.1
546 0.11
547 0.11
548 0.1
549 0.1
550 0.08
551 0.08
552 0.08
553 0.09
554 0.09
555 0.11
556 0.16
557 0.16
558 0.22
559 0.27
560 0.27
561 0.31
562 0.33