FuNGI

A0A1Y2M1U6

Protein Details

Accession

A0A1Y2M1U6

Localization Confidence

Medium

Confidence Score

13.4

NoLS Segment(s)

Position	Sequence	Protein Nature
179-209	VDLPERPKTPPRKRPTRRPTQKAKKWTFDKT	Basic

NLS Segment(s)

Position	Sequence
184-203	RPKTPPRKRPTRRPTQKAKK

Subcellular Location(s)

nucl 19.5, cyto_nucl 11.5, mito 5

Family & Domain DBs

InterPro	View protein in InterPro IPR024758 Inp1
Gene Ontology	GO:0005780 C:extrinsic component of intraperoxisomal membrane GO:0045033 P:peroxisome inheritance
Pfam	View protein in Pfam PF12634 Inp1

Amino Acid Sequences

MSSPLAPSRTSEQAPPPLHSSRRSFTVPARLRSSPAPAPASTSIADGIETLVVCPHSKIVSFAAAGTSAAGAGNQIAWTTPTERTLAVGVLRIYRVTASNVSFLNSGNLLHTIFPRSQCWCVDGQSVFVLRIRQDSYYRMELPFETDDDKAKIEQFKTVLSQVLQYEKTQCPFRQNVEVDLPERPKTPPRKRPTRRPTQKAKKWTFDKTWMPEDGSRPSTPVREGLDSANTSSYEEDDQSSVHTDTSDLPVPETPNTIFEDTPPPKAVRRLSVAERAQLFQSPRSVTAPLSIARDRSFSSASSMGCIPEMSKEEEKRSPQDSIARPAPIERKPSSDAASLLSGSSSFYSLETARRSPSPPFLDAEAEILDPWVDSLPAQNDVRGRARHRRDASEMTVRAVSTDYASKSSAVTPVVPLQPITTPSIALRPSSAPHTPPLVSDSDEDSLGQPSLDVPTPPNMIRMRKLTGASPRRAFSPMPHPQNLNFPTRQKPDQKFTAALVRKTYEIVLGPPQHLVSLMLRIAASISNGFGFSTYRVRRTKSIPGAWESSGEEDEWEEDDFGIPLSNLGEPVRRTGQPGELD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.48
2	0.49
3	0.49
4	0.5
5	0.53
6	0.54
7	0.54
8	0.48
9	0.51
10	0.52
11	0.5
12	0.49
13	0.56
14	0.57
15	0.57
16	0.59
17	0.55
18	0.54
19	0.53
20	0.54
21	0.48
22	0.46
23	0.43
24	0.37
25	0.41
26	0.4
27	0.39
28	0.32
29	0.28
30	0.23
31	0.18
32	0.18
33	0.13
34	0.11
35	0.09
36	0.09
37	0.08
38	0.09
39	0.1
40	0.1
41	0.11
42	0.12
43	0.12
44	0.13
45	0.15
46	0.15
47	0.18
48	0.18
49	0.17
50	0.16
51	0.15
52	0.15
53	0.13
54	0.1
55	0.07
56	0.06
57	0.06
58	0.05
59	0.04
60	0.05
61	0.05
62	0.05
63	0.05
64	0.06
65	0.09
66	0.12
67	0.13
68	0.14
69	0.16
70	0.16
71	0.17
72	0.17
73	0.17
74	0.14
75	0.16
76	0.15
77	0.16
78	0.16
79	0.15
80	0.14
81	0.14
82	0.14
83	0.15
84	0.18
85	0.17
86	0.2
87	0.2
88	0.21
89	0.21
90	0.19
91	0.18
92	0.15
93	0.13
94	0.11
95	0.12
96	0.11
97	0.12
98	0.13
99	0.14
100	0.17
101	0.19
102	0.21
103	0.24
104	0.27
105	0.26
106	0.27
107	0.26
108	0.26
109	0.29
110	0.26
111	0.23
112	0.23
113	0.23
114	0.21
115	0.2
116	0.2
117	0.15
118	0.19
119	0.19
120	0.19
121	0.2
122	0.23
123	0.27
124	0.3
125	0.32
126	0.28
127	0.28
128	0.26
129	0.28
130	0.26
131	0.22
132	0.19
133	0.17
134	0.19
135	0.19
136	0.2
137	0.16
138	0.19
139	0.22
140	0.21
141	0.24
142	0.22
143	0.23
144	0.24
145	0.24
146	0.23
147	0.18
148	0.2
149	0.18
150	0.22
151	0.21
152	0.2
153	0.24
154	0.24
155	0.28
156	0.31
157	0.31
158	0.33
159	0.36
160	0.39
161	0.42
162	0.41
163	0.41
164	0.4
165	0.41
166	0.35
167	0.36
168	0.35
169	0.27
170	0.27
171	0.25
172	0.29
173	0.38
174	0.47
175	0.53
176	0.6
177	0.7
178	0.78
179	0.87
180	0.89
181	0.9
182	0.9
183	0.9
184	0.91
185	0.91
186	0.91
187	0.9
188	0.88
189	0.86
190	0.81
191	0.8
192	0.74
193	0.71
194	0.69
195	0.64
196	0.6
197	0.52
198	0.48
199	0.43
200	0.41
201	0.37
202	0.33
203	0.28
204	0.25
205	0.25
206	0.24
207	0.22
208	0.23
209	0.2
210	0.18
211	0.19
212	0.19
213	0.21
214	0.2
215	0.2
216	0.17
217	0.14
218	0.13
219	0.12
220	0.12
221	0.09
222	0.09
223	0.09
224	0.08
225	0.08
226	0.08
227	0.11
228	0.1
229	0.09
230	0.08
231	0.08
232	0.09
233	0.12
234	0.14
235	0.12
236	0.12
237	0.14
238	0.15
239	0.14
240	0.15
241	0.12
242	0.11
243	0.14
244	0.14
245	0.13
246	0.13
247	0.22
248	0.22
249	0.24
250	0.24
251	0.23
252	0.23
253	0.28
254	0.29
255	0.23
256	0.26
257	0.28
258	0.29
259	0.37
260	0.36
261	0.35
262	0.33
263	0.3
264	0.26
265	0.25
266	0.23
267	0.16
268	0.18
269	0.16
270	0.16
271	0.16
272	0.17
273	0.14
274	0.15
275	0.15
276	0.13
277	0.16
278	0.16
279	0.15
280	0.15
281	0.16
282	0.15
283	0.15
284	0.15
285	0.12
286	0.14
287	0.15
288	0.15
289	0.15
290	0.14
291	0.12
292	0.11
293	0.11
294	0.08
295	0.08
296	0.1
297	0.12
298	0.16
299	0.18
300	0.22
301	0.26
302	0.29
303	0.31
304	0.32
305	0.29
306	0.27
307	0.34
308	0.32
309	0.34
310	0.35
311	0.31
312	0.29
313	0.3
314	0.34
315	0.3
316	0.33
317	0.28
318	0.29
319	0.32
320	0.34
321	0.33
322	0.29
323	0.26
324	0.21
325	0.21
326	0.16
327	0.13
328	0.11
329	0.08
330	0.07
331	0.07
332	0.06
333	0.05
334	0.05
335	0.07
336	0.08
337	0.11
338	0.14
339	0.15
340	0.16
341	0.18
342	0.2
343	0.21
344	0.28
345	0.28
346	0.27
347	0.27
348	0.27
349	0.27
350	0.25
351	0.24
352	0.16
353	0.12
354	0.11
355	0.09
356	0.07
357	0.05
358	0.05
359	0.04
360	0.03
361	0.03
362	0.06
363	0.07
364	0.12
365	0.12
366	0.14
367	0.15
368	0.19
369	0.24
370	0.26
371	0.3
372	0.36
373	0.43
374	0.51
375	0.54
376	0.55
377	0.56
378	0.57
379	0.58
380	0.57
381	0.51
382	0.43
383	0.4
384	0.34
385	0.28
386	0.23
387	0.18
388	0.1
389	0.13
390	0.12
391	0.13
392	0.14
393	0.14
394	0.14
395	0.15
396	0.16
397	0.13
398	0.13
399	0.13
400	0.17
401	0.18
402	0.17
403	0.16
404	0.15
405	0.16
406	0.17
407	0.18
408	0.14
409	0.13
410	0.14
411	0.18
412	0.18
413	0.16
414	0.16
415	0.15
416	0.16
417	0.2
418	0.22
419	0.19
420	0.21
421	0.25
422	0.23
423	0.22
424	0.24
425	0.2
426	0.19
427	0.19
428	0.2
429	0.17
430	0.17
431	0.17
432	0.15
433	0.14
434	0.13
435	0.11
436	0.08
437	0.07
438	0.1
439	0.1
440	0.1
441	0.1
442	0.14
443	0.18
444	0.18
445	0.24
446	0.26
447	0.29
448	0.34
449	0.37
450	0.37
451	0.38
452	0.39
453	0.38
454	0.44
455	0.48
456	0.51
457	0.51
458	0.48
459	0.46
460	0.48
461	0.43
462	0.38
463	0.41
464	0.43
465	0.46
466	0.48
467	0.48
468	0.47
469	0.56
470	0.54
471	0.5
472	0.46
473	0.43
474	0.49
475	0.53
476	0.59
477	0.59
478	0.63
479	0.64
480	0.67
481	0.67
482	0.6
483	0.57
484	0.59
485	0.55
486	0.5
487	0.47
488	0.41
489	0.36
490	0.35
491	0.33
492	0.25
493	0.2
494	0.2
495	0.23
496	0.24
497	0.24
498	0.25
499	0.24
500	0.22
501	0.21
502	0.2
503	0.14
504	0.15
505	0.14
506	0.14
507	0.14
508	0.14
509	0.14
510	0.12
511	0.12
512	0.09
513	0.09
514	0.09
515	0.09
516	0.09
517	0.09
518	0.09
519	0.11
520	0.2
521	0.24
522	0.31
523	0.36
524	0.41
525	0.46
526	0.51
527	0.59
528	0.6
529	0.63
530	0.61
531	0.62
532	0.62
533	0.57
534	0.53
535	0.44
536	0.37
537	0.3
538	0.24
539	0.19
540	0.15
541	0.16
542	0.14
543	0.14
544	0.11
545	0.1
546	0.11
547	0.11
548	0.1
549	0.1
550	0.08
551	0.08
552	0.08
553	0.09
554	0.09
555	0.11
556	0.16
557	0.16
558	0.22
559	0.27
560	0.27
561	0.31
562	0.33

A0A1Y2M1U6

3D AlphaFold-predicted Structure Viewer