Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2LHX1

Protein Details
Accession A0A1Y2LHX1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
18-38TCTRCGGPSRRSRPAARRWLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001227  Ac_transferase_dom_sf  
IPR014043  Acyl_transferase  
IPR016035  Acyl_Trfase/lysoPLipase  
IPR003965  Fatty_acid_synthase  
IPR016036  Malonyl_transacylase_ACP-bd  
Gene Ontology GO:0005835  C:fatty acid synthase complex  
GO:0004312  F:fatty acid synthase activity  
GO:0006633  P:fatty acid biosynthetic process  
Pfam View protein in Pfam  
PF00698  Acyl_transf_1  
Amino Acid Sequences MSNHCISISRIVPRVEATCTRCGGPSRRSRPAARRWLSLSTAQRPKTAIFFPGQGVQRVGMITPWLEAFPRTAKPILEEIDETLKLPRNPLTKMIESGTNTELTYTENAQPAIMATSILILRILEQEFGFNIAERVDITLGHSLGEFAALVAGGYLTFQDALKMVRRRAEVASKCSKEAVAQEGGEFGMVALVCESEEHMTALVAAIHEFLRLGGSRSDSNDDLPAVQQVLIANINSKNQIVLSGSIARINTLLANLRQFGGHDPRAVRLKSDTPFHGPLMEPTYDLVKRMLYKQKPDGSDIVTWPGLIPCVSNVTGRPYESREQLKDLLARSCVETVQWWKSVKYLHEEEKVRRYVGIGPGKVGRNLVGKEVGMKGAVKGGGVWGITSPKEMEEVVRALDDTETIED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.38
4 0.37
5 0.37
6 0.38
7 0.38
8 0.38
9 0.43
10 0.45
11 0.47
12 0.53
13 0.56
14 0.64
15 0.7
16 0.75
17 0.78
18 0.81
19 0.83
20 0.77
21 0.74
22 0.69
23 0.68
24 0.62
25 0.6
26 0.58
27 0.56
28 0.6
29 0.56
30 0.54
31 0.5
32 0.49
33 0.46
34 0.4
35 0.34
36 0.27
37 0.28
38 0.27
39 0.32
40 0.33
41 0.29
42 0.28
43 0.25
44 0.23
45 0.21
46 0.19
47 0.13
48 0.12
49 0.1
50 0.09
51 0.1
52 0.09
53 0.09
54 0.09
55 0.12
56 0.15
57 0.17
58 0.2
59 0.21
60 0.21
61 0.24
62 0.28
63 0.27
64 0.26
65 0.24
66 0.23
67 0.25
68 0.25
69 0.22
70 0.21
71 0.24
72 0.22
73 0.24
74 0.27
75 0.27
76 0.29
77 0.35
78 0.38
79 0.35
80 0.37
81 0.36
82 0.36
83 0.33
84 0.34
85 0.29
86 0.23
87 0.21
88 0.19
89 0.17
90 0.14
91 0.14
92 0.14
93 0.16
94 0.17
95 0.17
96 0.16
97 0.16
98 0.14
99 0.14
100 0.11
101 0.07
102 0.05
103 0.07
104 0.07
105 0.07
106 0.06
107 0.05
108 0.06
109 0.09
110 0.09
111 0.09
112 0.09
113 0.09
114 0.09
115 0.11
116 0.11
117 0.08
118 0.08
119 0.07
120 0.07
121 0.07
122 0.07
123 0.06
124 0.06
125 0.07
126 0.09
127 0.09
128 0.09
129 0.09
130 0.08
131 0.08
132 0.08
133 0.06
134 0.03
135 0.03
136 0.03
137 0.03
138 0.02
139 0.02
140 0.02
141 0.02
142 0.02
143 0.03
144 0.03
145 0.03
146 0.04
147 0.05
148 0.06
149 0.13
150 0.17
151 0.19
152 0.23
153 0.24
154 0.27
155 0.29
156 0.37
157 0.34
158 0.38
159 0.46
160 0.42
161 0.42
162 0.4
163 0.36
164 0.28
165 0.26
166 0.23
167 0.16
168 0.15
169 0.14
170 0.14
171 0.14
172 0.12
173 0.1
174 0.05
175 0.04
176 0.04
177 0.04
178 0.03
179 0.03
180 0.03
181 0.03
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.03
193 0.04
194 0.04
195 0.04
196 0.04
197 0.04
198 0.05
199 0.05
200 0.06
201 0.06
202 0.08
203 0.09
204 0.11
205 0.14
206 0.14
207 0.14
208 0.14
209 0.13
210 0.11
211 0.11
212 0.1
213 0.07
214 0.07
215 0.07
216 0.06
217 0.07
218 0.07
219 0.07
220 0.08
221 0.09
222 0.1
223 0.1
224 0.1
225 0.09
226 0.08
227 0.09
228 0.08
229 0.08
230 0.09
231 0.11
232 0.11
233 0.13
234 0.13
235 0.12
236 0.11
237 0.1
238 0.08
239 0.07
240 0.09
241 0.09
242 0.1
243 0.1
244 0.11
245 0.1
246 0.11
247 0.14
248 0.19
249 0.19
250 0.21
251 0.22
252 0.25
253 0.31
254 0.31
255 0.28
256 0.25
257 0.29
258 0.29
259 0.32
260 0.31
261 0.31
262 0.34
263 0.33
264 0.31
265 0.25
266 0.25
267 0.25
268 0.22
269 0.16
270 0.14
271 0.19
272 0.17
273 0.18
274 0.16
275 0.14
276 0.16
277 0.23
278 0.32
279 0.33
280 0.4
281 0.47
282 0.53
283 0.53
284 0.54
285 0.5
286 0.44
287 0.42
288 0.36
289 0.32
290 0.25
291 0.23
292 0.2
293 0.17
294 0.14
295 0.1
296 0.1
297 0.06
298 0.1
299 0.11
300 0.12
301 0.13
302 0.19
303 0.21
304 0.22
305 0.24
306 0.25
307 0.29
308 0.35
309 0.41
310 0.37
311 0.4
312 0.41
313 0.42
314 0.41
315 0.39
316 0.36
317 0.3
318 0.28
319 0.26
320 0.24
321 0.2
322 0.17
323 0.19
324 0.22
325 0.25
326 0.29
327 0.29
328 0.28
329 0.31
330 0.35
331 0.34
332 0.36
333 0.38
334 0.4
335 0.47
336 0.53
337 0.56
338 0.6
339 0.6
340 0.53
341 0.46
342 0.41
343 0.38
344 0.42
345 0.45
346 0.36
347 0.36
348 0.41
349 0.43
350 0.43
351 0.37
352 0.31
353 0.29
354 0.29
355 0.3
356 0.26
357 0.24
358 0.26
359 0.27
360 0.25
361 0.2
362 0.19
363 0.16
364 0.17
365 0.18
366 0.14
367 0.13
368 0.13
369 0.14
370 0.13
371 0.13
372 0.1
373 0.13
374 0.14
375 0.15
376 0.15
377 0.13
378 0.15
379 0.15
380 0.15
381 0.17
382 0.18
383 0.18
384 0.18
385 0.17
386 0.16
387 0.16
388 0.14