Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AYS2

Protein Details
Accession G3AYS2    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
39-69SSKSNSRRTASKYSYKQKNKSWFNKNKDSVIHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 7, plas 5, nucl 3, mito 3, extr 3, golg 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016020  C:membrane  
KEGG cten:CANTEDRAFT_129353  -  
Pfam View protein in Pfam  
PF03452  Anp1  
Amino Acid Sequences MGILHHPIARNIRRKPLTVVAPLAVIFMLYLFLFSHRDSSKSNSRRTASKYSYKQKNKSWFNKNKDSVILRNLPKNHLSHYDLNQLTVSSTPLENKEEVLILTPMSKFLPEYWDNLNRLTYDHSLISLGFILPRTEDGNVALRKLEIAIKATQGNPVTKFKKITVLRQDSNSLESQLEKDRHAFSVQKPRRALMALARNSLVFTTISPSTSWVLWLDSDIIETPHSVIQEMAAHDKPVLSANVYQRFYNEESKKNDIRPYDFNNWVESEEGLKLASTLGEDEIVVEGYAEMATYRPLMAHFYDHNGDKNTEMALDGVGGGAVLVKADVHRDGAMFPSFPFYHLIETEGFARMAKRLGYEVFGLPNYLVYHYNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.65
3 0.64
4 0.62
5 0.59
6 0.56
7 0.46
8 0.43
9 0.39
10 0.33
11 0.24
12 0.16
13 0.1
14 0.06
15 0.06
16 0.05
17 0.05
18 0.05
19 0.07
20 0.09
21 0.1
22 0.17
23 0.17
24 0.2
25 0.22
26 0.3
27 0.39
28 0.45
29 0.53
30 0.55
31 0.57
32 0.62
33 0.66
34 0.69
35 0.67
36 0.69
37 0.71
38 0.73
39 0.81
40 0.83
41 0.84
42 0.83
43 0.86
44 0.86
45 0.86
46 0.87
47 0.87
48 0.86
49 0.88
50 0.84
51 0.77
52 0.74
53 0.69
54 0.62
55 0.59
56 0.59
57 0.52
58 0.54
59 0.53
60 0.5
61 0.49
62 0.46
63 0.42
64 0.4
65 0.42
66 0.41
67 0.42
68 0.47
69 0.42
70 0.42
71 0.38
72 0.32
73 0.26
74 0.21
75 0.17
76 0.09
77 0.1
78 0.12
79 0.14
80 0.17
81 0.16
82 0.16
83 0.16
84 0.15
85 0.14
86 0.14
87 0.12
88 0.09
89 0.11
90 0.1
91 0.1
92 0.1
93 0.1
94 0.08
95 0.09
96 0.16
97 0.15
98 0.18
99 0.23
100 0.29
101 0.3
102 0.31
103 0.31
104 0.25
105 0.24
106 0.25
107 0.21
108 0.17
109 0.16
110 0.15
111 0.14
112 0.14
113 0.13
114 0.1
115 0.08
116 0.06
117 0.07
118 0.07
119 0.06
120 0.08
121 0.08
122 0.08
123 0.08
124 0.09
125 0.16
126 0.16
127 0.17
128 0.16
129 0.14
130 0.14
131 0.15
132 0.15
133 0.09
134 0.11
135 0.12
136 0.14
137 0.15
138 0.16
139 0.18
140 0.18
141 0.19
142 0.2
143 0.27
144 0.27
145 0.28
146 0.29
147 0.27
148 0.34
149 0.34
150 0.4
151 0.43
152 0.48
153 0.48
154 0.48
155 0.5
156 0.41
157 0.41
158 0.33
159 0.24
160 0.16
161 0.15
162 0.14
163 0.17
164 0.18
165 0.16
166 0.18
167 0.18
168 0.18
169 0.2
170 0.21
171 0.21
172 0.31
173 0.34
174 0.38
175 0.38
176 0.37
177 0.37
178 0.35
179 0.31
180 0.27
181 0.32
182 0.27
183 0.28
184 0.27
185 0.26
186 0.25
187 0.23
188 0.17
189 0.08
190 0.06
191 0.08
192 0.08
193 0.09
194 0.09
195 0.11
196 0.11
197 0.11
198 0.11
199 0.08
200 0.09
201 0.08
202 0.08
203 0.08
204 0.06
205 0.07
206 0.07
207 0.07
208 0.06
209 0.06
210 0.07
211 0.07
212 0.07
213 0.07
214 0.07
215 0.07
216 0.09
217 0.1
218 0.13
219 0.12
220 0.12
221 0.12
222 0.13
223 0.12
224 0.12
225 0.11
226 0.09
227 0.13
228 0.2
229 0.27
230 0.28
231 0.28
232 0.26
233 0.3
234 0.32
235 0.37
236 0.35
237 0.35
238 0.39
239 0.46
240 0.5
241 0.5
242 0.51
243 0.46
244 0.46
245 0.45
246 0.47
247 0.48
248 0.49
249 0.46
250 0.44
251 0.4
252 0.36
253 0.31
254 0.23
255 0.18
256 0.12
257 0.12
258 0.09
259 0.08
260 0.07
261 0.07
262 0.06
263 0.05
264 0.05
265 0.05
266 0.06
267 0.06
268 0.06
269 0.06
270 0.06
271 0.06
272 0.05
273 0.04
274 0.04
275 0.04
276 0.04
277 0.04
278 0.04
279 0.04
280 0.05
281 0.05
282 0.05
283 0.06
284 0.09
285 0.1
286 0.14
287 0.14
288 0.19
289 0.23
290 0.24
291 0.28
292 0.28
293 0.28
294 0.24
295 0.24
296 0.2
297 0.16
298 0.15
299 0.11
300 0.08
301 0.07
302 0.06
303 0.05
304 0.05
305 0.04
306 0.03
307 0.03
308 0.03
309 0.03
310 0.03
311 0.03
312 0.04
313 0.07
314 0.08
315 0.09
316 0.1
317 0.11
318 0.11
319 0.15
320 0.16
321 0.15
322 0.14
323 0.19
324 0.19
325 0.19
326 0.22
327 0.19
328 0.21
329 0.21
330 0.23
331 0.18
332 0.19
333 0.2
334 0.19
335 0.18
336 0.15
337 0.15
338 0.15
339 0.17
340 0.16
341 0.16
342 0.18
343 0.19
344 0.21
345 0.23
346 0.23
347 0.24
348 0.23
349 0.22
350 0.19
351 0.2
352 0.19
353 0.18