Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2ME12

Protein Details
Accession A0A1Y2ME12   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
65-84PSSSESKPVKKRKSWGQVLPHydrophilic
NLS Segment(s)
PositionSequence
71-125KPVKKRKSWGQVLPEPKTSLPPRKRAKTEDEKEQRRIERVKRNRLAAHNSRERKR
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000837  AP-1  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR044280  Hac1/HY5  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0006986  P:response to unfolded protein  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14710  bZIP_HAC1-like  
Amino Acid Sequences MDTTTFFSETMTTPAMMASGPLTPPHTESAPTTIKMEDLQVPYTTPSPSPSNMYTPEPSSQTPAPSSSESKPVKKRKSWGQVLPEPKTSLPPRKRAKTEDEKEQRRIERVKRNRLAAHNSRERKRQETEHLQKEKDKLENEMAQLRAKAARVDRLEAELSYWHQKYPGEKADTPDLSFSFTQANTMNPSQALTAPPFSPISMDSADSPRDSSCQPETPASTFEAAPEFDLTQYPAAMLCDLQFVHPVDSKPPVLEDLFDFDQFSGNTLSVEPTVSLSHNDDFFGTAFFGSGSISDYSGFSDGFDAKFSDMQSASGAPFGCDEVLAADN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.12
4 0.11
5 0.08
6 0.08
7 0.09
8 0.1
9 0.13
10 0.14
11 0.16
12 0.19
13 0.19
14 0.19
15 0.2
16 0.26
17 0.28
18 0.28
19 0.28
20 0.24
21 0.24
22 0.23
23 0.24
24 0.23
25 0.21
26 0.22
27 0.21
28 0.22
29 0.23
30 0.24
31 0.22
32 0.17
33 0.18
34 0.2
35 0.21
36 0.25
37 0.26
38 0.29
39 0.31
40 0.35
41 0.34
42 0.34
43 0.35
44 0.33
45 0.31
46 0.32
47 0.3
48 0.29
49 0.28
50 0.26
51 0.27
52 0.27
53 0.3
54 0.27
55 0.35
56 0.37
57 0.44
58 0.52
59 0.59
60 0.65
61 0.67
62 0.73
63 0.74
64 0.8
65 0.8
66 0.78
67 0.78
68 0.76
69 0.78
70 0.74
71 0.66
72 0.57
73 0.49
74 0.48
75 0.45
76 0.48
77 0.46
78 0.52
79 0.59
80 0.65
81 0.71
82 0.7
83 0.73
84 0.74
85 0.72
86 0.73
87 0.74
88 0.72
89 0.72
90 0.73
91 0.66
92 0.61
93 0.64
94 0.62
95 0.62
96 0.65
97 0.7
98 0.69
99 0.72
100 0.72
101 0.7
102 0.71
103 0.68
104 0.68
105 0.66
106 0.68
107 0.66
108 0.68
109 0.65
110 0.62
111 0.58
112 0.55
113 0.55
114 0.58
115 0.63
116 0.66
117 0.67
118 0.64
119 0.62
120 0.6
121 0.55
122 0.49
123 0.4
124 0.33
125 0.32
126 0.34
127 0.31
128 0.31
129 0.28
130 0.24
131 0.23
132 0.2
133 0.17
134 0.15
135 0.16
136 0.13
137 0.18
138 0.18
139 0.2
140 0.2
141 0.21
142 0.21
143 0.18
144 0.17
145 0.11
146 0.12
147 0.15
148 0.14
149 0.12
150 0.13
151 0.14
152 0.16
153 0.21
154 0.26
155 0.27
156 0.28
157 0.3
158 0.35
159 0.35
160 0.33
161 0.28
162 0.22
163 0.19
164 0.17
165 0.16
166 0.12
167 0.11
168 0.12
169 0.11
170 0.12
171 0.13
172 0.13
173 0.13
174 0.11
175 0.12
176 0.11
177 0.11
178 0.11
179 0.09
180 0.11
181 0.1
182 0.12
183 0.12
184 0.11
185 0.11
186 0.1
187 0.12
188 0.1
189 0.11
190 0.11
191 0.13
192 0.14
193 0.14
194 0.14
195 0.11
196 0.12
197 0.12
198 0.15
199 0.16
200 0.19
201 0.21
202 0.23
203 0.25
204 0.25
205 0.26
206 0.24
207 0.21
208 0.17
209 0.16
210 0.15
211 0.13
212 0.12
213 0.11
214 0.1
215 0.09
216 0.1
217 0.1
218 0.09
219 0.08
220 0.08
221 0.07
222 0.07
223 0.07
224 0.07
225 0.06
226 0.07
227 0.07
228 0.08
229 0.11
230 0.11
231 0.14
232 0.17
233 0.17
234 0.18
235 0.22
236 0.22
237 0.19
238 0.19
239 0.19
240 0.16
241 0.16
242 0.15
243 0.18
244 0.19
245 0.18
246 0.18
247 0.16
248 0.18
249 0.16
250 0.17
251 0.12
252 0.1
253 0.1
254 0.1
255 0.12
256 0.09
257 0.1
258 0.09
259 0.09
260 0.1
261 0.11
262 0.13
263 0.15
264 0.17
265 0.17
266 0.17
267 0.16
268 0.16
269 0.15
270 0.14
271 0.11
272 0.09
273 0.08
274 0.08
275 0.08
276 0.06
277 0.06
278 0.08
279 0.08
280 0.08
281 0.09
282 0.09
283 0.11
284 0.12
285 0.12
286 0.09
287 0.11
288 0.13
289 0.12
290 0.14
291 0.13
292 0.13
293 0.16
294 0.16
295 0.18
296 0.17
297 0.17
298 0.17
299 0.18
300 0.17
301 0.18
302 0.17
303 0.13
304 0.13
305 0.14
306 0.12
307 0.1
308 0.1