Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9NLW8

Protein Details
Accession G9NLW8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
51-71QKGTAARKKKVEKRRPLHFCIBasic
NLS Segment(s)
PositionSequence
55-65AARKKKVEKRR
Subcellular Location(s) extr 12, plas 8, E.R. 2, vacu 2, mito 1, pero 1, golg 1
Family & Domain DBs
Amino Acid Sequences MYVLLLLLLLLLLPLPLPVVTCCGLALLPAPLWHSPSRFETAPIDRSSSTQKGTAARKKKVEKRRPLHFCIAVPKTRPPLARLFAQSENPFCDREERRRASIPWPFAENARDTPSRVQPVPCQGGALDSSTTQTATAATLTLTFVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.04
4 0.05
5 0.05
6 0.09
7 0.1
8 0.1
9 0.1
10 0.1
11 0.1
12 0.09
13 0.1
14 0.08
15 0.07
16 0.08
17 0.1
18 0.1
19 0.14
20 0.16
21 0.16
22 0.18
23 0.21
24 0.25
25 0.23
26 0.25
27 0.27
28 0.3
29 0.33
30 0.31
31 0.31
32 0.26
33 0.28
34 0.32
35 0.29
36 0.25
37 0.22
38 0.24
39 0.27
40 0.35
41 0.42
42 0.45
43 0.48
44 0.55
45 0.62
46 0.69
47 0.74
48 0.76
49 0.78
50 0.78
51 0.82
52 0.82
53 0.78
54 0.75
55 0.66
56 0.58
57 0.55
58 0.5
59 0.43
60 0.37
61 0.34
62 0.31
63 0.33
64 0.32
65 0.26
66 0.29
67 0.29
68 0.31
69 0.3
70 0.31
71 0.3
72 0.33
73 0.32
74 0.27
75 0.28
76 0.25
77 0.23
78 0.19
79 0.25
80 0.25
81 0.32
82 0.41
83 0.42
84 0.45
85 0.49
86 0.51
87 0.51
88 0.54
89 0.5
90 0.42
91 0.41
92 0.37
93 0.35
94 0.35
95 0.3
96 0.26
97 0.26
98 0.25
99 0.24
100 0.28
101 0.33
102 0.36
103 0.36
104 0.36
105 0.36
106 0.43
107 0.46
108 0.41
109 0.35
110 0.29
111 0.29
112 0.27
113 0.24
114 0.16
115 0.11
116 0.13
117 0.12
118 0.13
119 0.11
120 0.1
121 0.08
122 0.08
123 0.08
124 0.07
125 0.07
126 0.07