Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2MBH2

Protein Details
Accession A0A1Y2MBH2    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MAKSKNSSQHNQSKKNHRNGIKKPKTNRYPSLKHydrophilic
NLS Segment(s)
PositionSequence
14-61KKNHRNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGK
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSKKNHRNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRDAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.85
4 0.84
5 0.84
6 0.85
7 0.87
8 0.86
9 0.85
10 0.83
11 0.85
12 0.85
13 0.82
14 0.8
15 0.78
16 0.74
17 0.7
18 0.67
19 0.61
20 0.57
21 0.52
22 0.54
23 0.5
24 0.52
25 0.56
26 0.59
27 0.64
28 0.66
29 0.72
30 0.66
31 0.71
32 0.65
33 0.65
34 0.63
35 0.58
36 0.55
37 0.5
38 0.47
39 0.4
40 0.38
41 0.3
42 0.32
43 0.35
44 0.38
45 0.4