Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2LMB8

Protein Details
Accession A0A1Y2LMB8    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
159-178VPPLAPPCPRPRPLPRRPCLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001660  SAM  
IPR013761  SAM/pointed_sf  
Pfam View protein in Pfam  
PF07647  SAM_2  
PROSITE View protein in PROSITE  
PS50105  SAM_DOMAIN  
CDD cd09533  SAM_Ste50-like_fungal  
Amino Acid Sequences MAYSNNNNSNNNNMSKYHEDSDADDEFERTAWQQRDQIPVEYESSPTSSGPLSTEHTPTTFTHSRDSRISPTGLIVDWSAEQVADFVSDLGLEQYCDTFVDEGITGDALVSLQHAELKEMGVGSVGHRLTMLKAVYDIKVKQNVPVEPDDYVPLCRCPVPPLAPPCPRPRPLPRRPCLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.44
4 0.39
5 0.37
6 0.34
7 0.34
8 0.38
9 0.32
10 0.28
11 0.24
12 0.22
13 0.18
14 0.17
15 0.15
16 0.11
17 0.18
18 0.19
19 0.22
20 0.27
21 0.31
22 0.38
23 0.4
24 0.42
25 0.36
26 0.35
27 0.35
28 0.3
29 0.27
30 0.2
31 0.19
32 0.16
33 0.14
34 0.13
35 0.1
36 0.1
37 0.1
38 0.11
39 0.13
40 0.15
41 0.17
42 0.16
43 0.17
44 0.19
45 0.18
46 0.24
47 0.25
48 0.24
49 0.3
50 0.31
51 0.34
52 0.34
53 0.37
54 0.33
55 0.31
56 0.3
57 0.23
58 0.22
59 0.19
60 0.16
61 0.14
62 0.1
63 0.08
64 0.07
65 0.07
66 0.06
67 0.05
68 0.04
69 0.04
70 0.04
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.04
84 0.05
85 0.04
86 0.04
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.04
93 0.04
94 0.04
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.05
101 0.05
102 0.06
103 0.06
104 0.07
105 0.07
106 0.07
107 0.07
108 0.06
109 0.06
110 0.06
111 0.11
112 0.1
113 0.1
114 0.1
115 0.11
116 0.11
117 0.15
118 0.14
119 0.09
120 0.11
121 0.13
122 0.15
123 0.19
124 0.21
125 0.22
126 0.29
127 0.29
128 0.32
129 0.36
130 0.36
131 0.36
132 0.37
133 0.34
134 0.28
135 0.28
136 0.26
137 0.21
138 0.22
139 0.19
140 0.18
141 0.18
142 0.19
143 0.19
144 0.19
145 0.25
146 0.28
147 0.34
148 0.4
149 0.48
150 0.54
151 0.58
152 0.64
153 0.66
154 0.65
155 0.66
156 0.69
157 0.71
158 0.74
159 0.8