Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2M308

Protein Details
Accession A0A1Y2M308   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
85-111NIFRCCEQRKAIKTRQKPHHGRHRSRYBasic
NLS Segment(s)
PositionSequence
96-109IKTRQKPHHGRHRS
Subcellular Location(s) plas 9extr 9, mito 5, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQLGSSSPSGMTYPLVSILLLSFAAHTNGLPIDLRTGNPDILTTRGEAKSEGKGLSDEAIIGIAAIFASIFLFILGLVLAAPRTNIFRCCEQRKAIKTRQKPHHGRHRSRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.09
4 0.09
5 0.08
6 0.08
7 0.07
8 0.06
9 0.06
10 0.06
11 0.07
12 0.07
13 0.07
14 0.07
15 0.07
16 0.08
17 0.07
18 0.07
19 0.1
20 0.1
21 0.11
22 0.13
23 0.15
24 0.14
25 0.14
26 0.14
27 0.12
28 0.13
29 0.13
30 0.1
31 0.13
32 0.13
33 0.14
34 0.14
35 0.15
36 0.15
37 0.17
38 0.16
39 0.12
40 0.12
41 0.12
42 0.12
43 0.1
44 0.07
45 0.05
46 0.05
47 0.04
48 0.04
49 0.03
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.03
62 0.03
63 0.02
64 0.02
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.08
71 0.1
72 0.13
73 0.16
74 0.25
75 0.33
76 0.4
77 0.45
78 0.49
79 0.57
80 0.63
81 0.69
82 0.71
83 0.73
84 0.77
85 0.81
86 0.85
87 0.86
88 0.88
89 0.89
90 0.9
91 0.91