Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2LVS5

Protein Details
Accession A0A1Y2LVS5   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
63-94PAPPSSPPKKSHKRGHPRKYRRDNKSKPIMTNBasic
NLS Segment(s)
PositionSequence
68-89SPPKKSHKRGHPRKYRRDNKSK
Subcellular Location(s) nucl 13.5, cyto_nucl 13, cyto 11.5
Family & Domain DBs
Amino Acid Sequences MADDEFQSPLEGLPLLKKALVATGRLAACEEVKEEAENETNDKIEAPEESEAAKSADFIPYIPAPPSSPPKKSHKRGHPRKYRRDNKSKPIMTNEDGTPIPKSRYGWIDGHKPKQKKADEIDDLQESGPEITQRAKDNLKGKESDGNAVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.14
5 0.13
6 0.18
7 0.19
8 0.17
9 0.17
10 0.22
11 0.22
12 0.22
13 0.22
14 0.17
15 0.16
16 0.15
17 0.15
18 0.1
19 0.11
20 0.11
21 0.11
22 0.12
23 0.15
24 0.15
25 0.15
26 0.14
27 0.14
28 0.14
29 0.13
30 0.12
31 0.09
32 0.09
33 0.09
34 0.09
35 0.09
36 0.1
37 0.1
38 0.1
39 0.1
40 0.09
41 0.08
42 0.07
43 0.08
44 0.08
45 0.08
46 0.1
47 0.1
48 0.11
49 0.11
50 0.11
51 0.1
52 0.13
53 0.21
54 0.23
55 0.26
56 0.31
57 0.4
58 0.5
59 0.58
60 0.65
61 0.68
62 0.75
63 0.82
64 0.87
65 0.89
66 0.89
67 0.91
68 0.93
69 0.92
70 0.91
71 0.91
72 0.89
73 0.87
74 0.87
75 0.81
76 0.73
77 0.7
78 0.65
79 0.56
80 0.51
81 0.41
82 0.34
83 0.29
84 0.27
85 0.22
86 0.18
87 0.18
88 0.17
89 0.18
90 0.19
91 0.22
92 0.25
93 0.27
94 0.3
95 0.39
96 0.44
97 0.52
98 0.57
99 0.57
100 0.59
101 0.63
102 0.64
103 0.61
104 0.61
105 0.61
106 0.59
107 0.59
108 0.58
109 0.5
110 0.46
111 0.38
112 0.31
113 0.21
114 0.16
115 0.13
116 0.1
117 0.09
118 0.12
119 0.17
120 0.2
121 0.25
122 0.29
123 0.35
124 0.43
125 0.49
126 0.5
127 0.49
128 0.47
129 0.5
130 0.48