Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2LPF3

Protein Details
Accession A0A1Y2LPF3    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
104-136LPPLYVQKKPSKPQQQRRRSSGKQRRTSQPMTPHydrophilic
NLS Segment(s)
PositionSequence
115-126KPQQQRRRSSGK
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MHFETSPGSSPSKSIPISISPRNMASPTGSLYSNYSVESNSRRGSSCAYPSWPTGPSLEYRNPSSYISDEDLFGEDFEDEYCPILKKAPAPPRVPPMAHAYPVLPPLYVQKKPSKPQQQRRRSSGKQRRTSQPMTPISESPEQQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.3
4 0.36
5 0.4
6 0.41
7 0.37
8 0.38
9 0.38
10 0.36
11 0.3
12 0.25
13 0.21
14 0.19
15 0.19
16 0.18
17 0.16
18 0.18
19 0.19
20 0.17
21 0.16
22 0.14
23 0.13
24 0.16
25 0.19
26 0.21
27 0.2
28 0.21
29 0.21
30 0.22
31 0.26
32 0.27
33 0.28
34 0.26
35 0.28
36 0.28
37 0.29
38 0.3
39 0.26
40 0.23
41 0.19
42 0.18
43 0.16
44 0.19
45 0.21
46 0.21
47 0.23
48 0.24
49 0.25
50 0.24
51 0.24
52 0.2
53 0.19
54 0.18
55 0.16
56 0.14
57 0.13
58 0.13
59 0.11
60 0.1
61 0.08
62 0.05
63 0.05
64 0.05
65 0.05
66 0.04
67 0.05
68 0.06
69 0.06
70 0.06
71 0.08
72 0.09
73 0.13
74 0.21
75 0.3
76 0.36
77 0.39
78 0.42
79 0.47
80 0.5
81 0.46
82 0.4
83 0.39
84 0.34
85 0.33
86 0.29
87 0.24
88 0.22
89 0.24
90 0.22
91 0.13
92 0.11
93 0.17
94 0.24
95 0.26
96 0.29
97 0.36
98 0.44
99 0.51
100 0.61
101 0.65
102 0.69
103 0.77
104 0.84
105 0.85
106 0.87
107 0.89
108 0.89
109 0.87
110 0.87
111 0.87
112 0.87
113 0.86
114 0.85
115 0.87
116 0.86
117 0.82
118 0.78
119 0.77
120 0.74
121 0.7
122 0.66
123 0.57
124 0.54
125 0.54