Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2LI85

Protein Details
Accession A0A1Y2LI85    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
4-23ADINRQVKKRHREPESPSIAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.333, mito_nucl 11.666, cyto 4
Family & Domain DBs
Amino Acid Sequences MHEADINRQVKKRHREPESPSIAGPIEPASKRLCFPNTAVPYIENLVNHWRRLGSWPDEYFQPDAMSNIFAQPALRRKRSPSYSFASSFSTHSSSSMSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.74
3 0.78
4 0.81
5 0.79
6 0.71
7 0.61
8 0.53
9 0.45
10 0.36
11 0.28
12 0.19
13 0.17
14 0.15
15 0.17
16 0.17
17 0.18
18 0.19
19 0.23
20 0.23
21 0.2
22 0.22
23 0.3
24 0.31
25 0.31
26 0.31
27 0.26
28 0.25
29 0.25
30 0.23
31 0.13
32 0.11
33 0.18
34 0.19
35 0.19
36 0.18
37 0.17
38 0.16
39 0.2
40 0.23
41 0.19
42 0.23
43 0.24
44 0.25
45 0.26
46 0.28
47 0.25
48 0.21
49 0.18
50 0.12
51 0.12
52 0.11
53 0.11
54 0.09
55 0.09
56 0.08
57 0.07
58 0.08
59 0.12
60 0.2
61 0.27
62 0.32
63 0.34
64 0.4
65 0.5
66 0.58
67 0.59
68 0.57
69 0.56
70 0.58
71 0.57
72 0.54
73 0.48
74 0.4
75 0.37
76 0.34
77 0.3
78 0.23
79 0.22