Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NJP1

Protein Details
Accession G9NJP1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
50-80ARAARHKARQQEKLRGKQRPKPLSARERRNFBasic
NLS Segment(s)
PositionSequence
50-78ARAARHKARQQEKLRGKQRPKPLSARERR
Subcellular Location(s) cyto_nucl 11, nucl 10, cyto 10, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016848  RNase_P/MRP_Rpp29-subunit  
IPR036980  RNase_P/MRP_Rpp29_sf  
IPR023534  Rof/RNase_P-like  
IPR002730  Rpp29/RNP1  
Gene Ontology GO:0005634  C:nucleus  
GO:0000172  C:ribonuclease MRP complex  
GO:0030677  C:ribonuclease P complex  
GO:0033204  F:ribonuclease P RNA binding  
GO:0001682  P:tRNA 5'-leader removal  
Pfam View protein in Pfam  
PF01868  RNase_P-MRP_p29  
Amino Acid Sequences MASSEQIKVTQDLLARAHSPDSANRIYSEKIQYRTLQLKPTSPPPAALNARAARHKARQQEKLRGKQRPKPLSARERRNFGLYDIPKQGQKYEVYEPLKKMWMGYALEILGNDIYTGGSLAAAKLASAEFHGAEAEVVRSRCPGRVGTKGIIVRDRKFVVELITKKRGLKVIPKEGTTFRVEVCVPQQPNNDTEKKTFAFEVLGDQMMLRSADRANRKFKSHFLKNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.22
4 0.22
5 0.21
6 0.21
7 0.21
8 0.26
9 0.26
10 0.26
11 0.27
12 0.28
13 0.28
14 0.32
15 0.37
16 0.37
17 0.38
18 0.41
19 0.42
20 0.46
21 0.51
22 0.49
23 0.48
24 0.44
25 0.45
26 0.45
27 0.51
28 0.5
29 0.43
30 0.41
31 0.35
32 0.41
33 0.39
34 0.37
35 0.37
36 0.35
37 0.38
38 0.39
39 0.4
40 0.37
41 0.42
42 0.46
43 0.48
44 0.52
45 0.59
46 0.63
47 0.71
48 0.76
49 0.78
50 0.81
51 0.82
52 0.81
53 0.79
54 0.81
55 0.79
56 0.76
57 0.74
58 0.75
59 0.77
60 0.79
61 0.82
62 0.76
63 0.73
64 0.68
65 0.62
66 0.53
67 0.43
68 0.43
69 0.34
70 0.34
71 0.32
72 0.31
73 0.3
74 0.3
75 0.29
76 0.23
77 0.22
78 0.21
79 0.22
80 0.28
81 0.3
82 0.33
83 0.33
84 0.32
85 0.33
86 0.28
87 0.25
88 0.18
89 0.17
90 0.15
91 0.14
92 0.13
93 0.11
94 0.11
95 0.11
96 0.1
97 0.06
98 0.05
99 0.04
100 0.03
101 0.03
102 0.03
103 0.03
104 0.02
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.04
115 0.05
116 0.04
117 0.05
118 0.05
119 0.04
120 0.04
121 0.05
122 0.05
123 0.07
124 0.08
125 0.08
126 0.1
127 0.11
128 0.12
129 0.14
130 0.17
131 0.19
132 0.26
133 0.3
134 0.3
135 0.35
136 0.35
137 0.35
138 0.38
139 0.37
140 0.33
141 0.33
142 0.33
143 0.28
144 0.27
145 0.25
146 0.23
147 0.27
148 0.31
149 0.33
150 0.38
151 0.4
152 0.4
153 0.42
154 0.41
155 0.37
156 0.41
157 0.44
158 0.49
159 0.5
160 0.51
161 0.51
162 0.5
163 0.5
164 0.43
165 0.34
166 0.24
167 0.23
168 0.22
169 0.21
170 0.22
171 0.26
172 0.25
173 0.29
174 0.34
175 0.33
176 0.37
177 0.41
178 0.44
179 0.39
180 0.4
181 0.4
182 0.36
183 0.37
184 0.33
185 0.28
186 0.24
187 0.21
188 0.23
189 0.19
190 0.18
191 0.15
192 0.15
193 0.14
194 0.14
195 0.14
196 0.09
197 0.09
198 0.11
199 0.18
200 0.28
201 0.35
202 0.43
203 0.48
204 0.54
205 0.56
206 0.63
207 0.66