Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2M4S5

Protein Details
Accession A0A1Y2M4S5    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
305-331LGDETPERKKKKKSAYIKKADRDKSERBasic
369-388GEEPRKKKIKLSLGGKERARBasic
NLS Segment(s)
PositionSequence
312-388RKKKKKSAYIKKADRDKSERSGSLKVKLKTGRPEVDRKASETSERSEGGKRDRDGDDGEEPRKKKIKLSLGGKERAR
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013246  SAGA_su_Sgf11  
Gene Ontology GO:0005634  C:nucleus  
GO:0070461  C:SAGA-type complex  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF08209  Sgf11  
Amino Acid Sequences MSEDAAGESASGLPPDTLPELIQDILEDTLSNIVLQTALSCHRAEKLLRMQSAATQAESIALAALEPASQKAGATSQPAIPAAETSAAKYENGRVLLKGNPLKTTPEIICPHCKLPRLMHPIMGKGMQHPDLTKEYCLLYPWVQRQGHDVYGNPFPTDMAKSKKERELIKQQQKNADKESVGTPGSQDTEMAGDTKEIKLNTGGKPASYIPWHTCPNCKRSLLITRFAQHLEKCLGISGRQSSRNAMAKLVGQNGSGSGLGNTPLGSRMGTPNPGLQGDSLVSKKGKGISPIKKAAHADDDADELGDETPERKKKKKSAYIKKADRDKSERSGSLKVKLKTGRPEVDRKASETSERSEGGKRDRDGDDGEEPRKKKIKLSLGGKERARASASVEPGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.11
3 0.12
4 0.12
5 0.12
6 0.13
7 0.15
8 0.15
9 0.15
10 0.12
11 0.11
12 0.11
13 0.11
14 0.09
15 0.07
16 0.08
17 0.09
18 0.08
19 0.07
20 0.06
21 0.07
22 0.06
23 0.07
24 0.08
25 0.1
26 0.13
27 0.13
28 0.14
29 0.17
30 0.22
31 0.23
32 0.29
33 0.36
34 0.41
35 0.42
36 0.42
37 0.4
38 0.39
39 0.45
40 0.38
41 0.28
42 0.21
43 0.2
44 0.19
45 0.18
46 0.14
47 0.07
48 0.06
49 0.05
50 0.05
51 0.05
52 0.04
53 0.05
54 0.05
55 0.06
56 0.07
57 0.07
58 0.07
59 0.1
60 0.11
61 0.14
62 0.16
63 0.16
64 0.18
65 0.19
66 0.19
67 0.17
68 0.15
69 0.13
70 0.14
71 0.13
72 0.12
73 0.14
74 0.14
75 0.14
76 0.15
77 0.18
78 0.18
79 0.21
80 0.21
81 0.19
82 0.21
83 0.24
84 0.31
85 0.32
86 0.29
87 0.29
88 0.29
89 0.32
90 0.32
91 0.33
92 0.26
93 0.3
94 0.32
95 0.34
96 0.4
97 0.39
98 0.43
99 0.41
100 0.44
101 0.39
102 0.4
103 0.47
104 0.48
105 0.46
106 0.47
107 0.45
108 0.43
109 0.42
110 0.38
111 0.28
112 0.22
113 0.25
114 0.21
115 0.2
116 0.19
117 0.2
118 0.23
119 0.24
120 0.22
121 0.19
122 0.18
123 0.18
124 0.19
125 0.17
126 0.16
127 0.2
128 0.24
129 0.31
130 0.3
131 0.3
132 0.33
133 0.34
134 0.34
135 0.29
136 0.27
137 0.21
138 0.25
139 0.25
140 0.21
141 0.18
142 0.14
143 0.15
144 0.16
145 0.17
146 0.19
147 0.24
148 0.28
149 0.33
150 0.38
151 0.42
152 0.43
153 0.47
154 0.53
155 0.58
156 0.64
157 0.64
158 0.63
159 0.67
160 0.68
161 0.64
162 0.57
163 0.49
164 0.38
165 0.35
166 0.33
167 0.27
168 0.21
169 0.17
170 0.14
171 0.12
172 0.13
173 0.11
174 0.1
175 0.07
176 0.07
177 0.07
178 0.07
179 0.06
180 0.05
181 0.06
182 0.07
183 0.09
184 0.08
185 0.09
186 0.11
187 0.16
188 0.16
189 0.21
190 0.2
191 0.18
192 0.2
193 0.2
194 0.19
195 0.16
196 0.17
197 0.15
198 0.2
199 0.24
200 0.23
201 0.3
202 0.32
203 0.36
204 0.39
205 0.36
206 0.33
207 0.34
208 0.43
209 0.4
210 0.42
211 0.4
212 0.37
213 0.38
214 0.38
215 0.35
216 0.25
217 0.25
218 0.2
219 0.18
220 0.15
221 0.15
222 0.14
223 0.12
224 0.14
225 0.16
226 0.19
227 0.23
228 0.23
229 0.24
230 0.29
231 0.35
232 0.33
233 0.28
234 0.25
235 0.25
236 0.27
237 0.28
238 0.23
239 0.16
240 0.16
241 0.15
242 0.15
243 0.12
244 0.09
245 0.06
246 0.06
247 0.07
248 0.07
249 0.07
250 0.06
251 0.07
252 0.07
253 0.07
254 0.08
255 0.11
256 0.14
257 0.16
258 0.16
259 0.18
260 0.19
261 0.19
262 0.18
263 0.14
264 0.13
265 0.12
266 0.14
267 0.12
268 0.14
269 0.13
270 0.13
271 0.16
272 0.19
273 0.21
274 0.26
275 0.35
276 0.41
277 0.49
278 0.57
279 0.56
280 0.56
281 0.56
282 0.51
283 0.46
284 0.38
285 0.31
286 0.24
287 0.24
288 0.19
289 0.18
290 0.15
291 0.1
292 0.09
293 0.07
294 0.07
295 0.07
296 0.14
297 0.22
298 0.28
299 0.35
300 0.44
301 0.54
302 0.65
303 0.74
304 0.78
305 0.82
306 0.87
307 0.91
308 0.92
309 0.91
310 0.9
311 0.87
312 0.84
313 0.8
314 0.75
315 0.72
316 0.69
317 0.65
318 0.59
319 0.61
320 0.56
321 0.58
322 0.59
323 0.52
324 0.53
325 0.55
326 0.57
327 0.58
328 0.63
329 0.62
330 0.6
331 0.68
332 0.68
333 0.72
334 0.67
335 0.61
336 0.58
337 0.52
338 0.52
339 0.46
340 0.43
341 0.38
342 0.37
343 0.36
344 0.37
345 0.4
346 0.42
347 0.47
348 0.44
349 0.45
350 0.46
351 0.46
352 0.43
353 0.43
354 0.43
355 0.41
356 0.46
357 0.48
358 0.47
359 0.53
360 0.57
361 0.53
362 0.52
363 0.56
364 0.6
365 0.62
366 0.71
367 0.72
368 0.73
369 0.81
370 0.76
371 0.72
372 0.64
373 0.57
374 0.5
375 0.41
376 0.38
377 0.37