Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2MF94

Protein Details
Accession A0A1Y2MF94    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-86ELLRNSKDKRARRLAKKRLGTFGRBasic
NLS Segment(s)
PositionSequence
67-90NSKDKRARRLAKKRLGTFGRAKRK
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MPKDVKQKSGIIAGVNAGHKVTPRTPAARISRRKGFLSKRTAFVREITREVAGLAPYEKRVIELLRNSKDKRARRLAKKRLGTFGRAKRKVEEMTKVISESRRAGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.2
4 0.15
5 0.13
6 0.13
7 0.17
8 0.17
9 0.19
10 0.22
11 0.25
12 0.27
13 0.35
14 0.43
15 0.49
16 0.55
17 0.57
18 0.61
19 0.61
20 0.62
21 0.62
22 0.62
23 0.61
24 0.63
25 0.59
26 0.56
27 0.56
28 0.55
29 0.48
30 0.43
31 0.41
32 0.34
33 0.32
34 0.28
35 0.25
36 0.22
37 0.21
38 0.18
39 0.11
40 0.09
41 0.07
42 0.07
43 0.07
44 0.08
45 0.07
46 0.07
47 0.08
48 0.09
49 0.13
50 0.19
51 0.26
52 0.32
53 0.38
54 0.39
55 0.45
56 0.52
57 0.55
58 0.57
59 0.6
60 0.64
61 0.69
62 0.79
63 0.83
64 0.85
65 0.87
66 0.82
67 0.81
68 0.75
69 0.7
70 0.69
71 0.69
72 0.7
73 0.67
74 0.64
75 0.58
76 0.61
77 0.62
78 0.58
79 0.56
80 0.49
81 0.48
82 0.48
83 0.45
84 0.43
85 0.39
86 0.36