Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2MAV4

Protein Details
Accession A0A1Y2MAV4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
229-248LEDVESWKKARKPKKECCMQHydrophilic
NLS Segment(s)
PositionSequence
237-241KARKP
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 5.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036770  Ankyrin_rpt-contain_sf  
Amino Acid Sequences MWRVVKNHARVKWCLENGASVYPRDFHPHKEGGITADQYYCEPILEVAVCRASVATFELLRSHGAQLGWRTLHRAVEFACRVTPPYYGRMTPTDTQVNFEPWSPSPWSPSPWREKHEKLHESQYKEQDEKQDEKPYVRDHKERMAMLRHLIDVVRLDVNADDTPPGAPHIEMRWGPPTEYILYSTDVTKDSRDVTWLLLDRGADPTPVYRAIERCGDDPDDESPERQVLEDVESWKKARKPKKECCMQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.46
3 0.44
4 0.41
5 0.45
6 0.38
7 0.29
8 0.28
9 0.25
10 0.26
11 0.29
12 0.29
13 0.27
14 0.33
15 0.35
16 0.35
17 0.36
18 0.36
19 0.32
20 0.35
21 0.31
22 0.24
23 0.22
24 0.21
25 0.19
26 0.2
27 0.16
28 0.12
29 0.1
30 0.09
31 0.09
32 0.1
33 0.1
34 0.09
35 0.1
36 0.1
37 0.1
38 0.1
39 0.08
40 0.07
41 0.09
42 0.1
43 0.09
44 0.1
45 0.11
46 0.12
47 0.13
48 0.14
49 0.13
50 0.13
51 0.13
52 0.15
53 0.16
54 0.2
55 0.2
56 0.19
57 0.21
58 0.2
59 0.24
60 0.21
61 0.21
62 0.18
63 0.25
64 0.26
65 0.23
66 0.23
67 0.19
68 0.21
69 0.21
70 0.23
71 0.16
72 0.2
73 0.21
74 0.21
75 0.23
76 0.24
77 0.27
78 0.25
79 0.27
80 0.29
81 0.26
82 0.28
83 0.27
84 0.27
85 0.23
86 0.22
87 0.2
88 0.15
89 0.18
90 0.18
91 0.17
92 0.2
93 0.21
94 0.23
95 0.26
96 0.32
97 0.38
98 0.4
99 0.43
100 0.45
101 0.49
102 0.54
103 0.59
104 0.57
105 0.5
106 0.56
107 0.58
108 0.56
109 0.57
110 0.55
111 0.48
112 0.45
113 0.44
114 0.4
115 0.39
116 0.38
117 0.36
118 0.36
119 0.34
120 0.34
121 0.35
122 0.35
123 0.39
124 0.4
125 0.4
126 0.37
127 0.42
128 0.46
129 0.44
130 0.41
131 0.37
132 0.34
133 0.31
134 0.29
135 0.23
136 0.19
137 0.17
138 0.15
139 0.1
140 0.1
141 0.09
142 0.07
143 0.07
144 0.07
145 0.09
146 0.09
147 0.08
148 0.07
149 0.07
150 0.07
151 0.07
152 0.08
153 0.06
154 0.06
155 0.08
156 0.09
157 0.14
158 0.14
159 0.16
160 0.21
161 0.21
162 0.22
163 0.21
164 0.22
165 0.2
166 0.2
167 0.2
168 0.16
169 0.17
170 0.17
171 0.17
172 0.16
173 0.15
174 0.15
175 0.14
176 0.14
177 0.14
178 0.14
179 0.15
180 0.15
181 0.14
182 0.19
183 0.19
184 0.19
185 0.18
186 0.18
187 0.17
188 0.19
189 0.18
190 0.13
191 0.12
192 0.13
193 0.14
194 0.16
195 0.17
196 0.17
197 0.19
198 0.22
199 0.27
200 0.28
201 0.27
202 0.29
203 0.29
204 0.27
205 0.27
206 0.26
207 0.26
208 0.25
209 0.25
210 0.23
211 0.22
212 0.21
213 0.2
214 0.18
215 0.13
216 0.16
217 0.19
218 0.22
219 0.25
220 0.28
221 0.29
222 0.34
223 0.39
224 0.44
225 0.5
226 0.57
227 0.63
228 0.71