Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2M8M9

Protein Details
Accession A0A1Y2M8M9    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
30-63ADKRAGGKKAPKKYRKYHKNTKTKNKKSGGNIASBasic
NLS Segment(s)
PositionSequence
32-58KRAGGKKAPKKYRKYHKNTKTKNKKSG
Subcellular Location(s) nucl 18, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MGFNTPSTQFGVSRSNARERLPPHSVYAIADKRAGGKKAPKKYRKYHKNTKTKNKKSGGNIASRAMHYIIDAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.37
4 0.39
5 0.42
6 0.39
7 0.45
8 0.43
9 0.4
10 0.35
11 0.34
12 0.32
13 0.27
14 0.32
15 0.27
16 0.23
17 0.22
18 0.19
19 0.22
20 0.25
21 0.25
22 0.2
23 0.27
24 0.34
25 0.43
26 0.54
27 0.58
28 0.63
29 0.72
30 0.8
31 0.83
32 0.84
33 0.85
34 0.86
35 0.88
36 0.9
37 0.92
38 0.92
39 0.91
40 0.91
41 0.87
42 0.85
43 0.81
44 0.81
45 0.75
46 0.72
47 0.66
48 0.6
49 0.56
50 0.48
51 0.44
52 0.34
53 0.27