Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3BBQ3

Protein Details
Accession G3BBQ3    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-31VNIPKTRKTYCKGKECRKHTQHKVTQYKAGHydrophilic
NLS Segment(s)
PositionSequence
58-63FKKKAK
Subcellular Location(s) nucl 12.5, cyto_nucl 10, mito 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cten:CANTEDRAFT_115674  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRKTYCKGKECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFKKKAKTTKKVVLRLECVNCKTKLQLSLKRCKHFELGGNKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.83
4 0.88
5 0.87
6 0.88
7 0.88
8 0.88
9 0.85
10 0.86
11 0.88
12 0.81
13 0.8
14 0.74
15 0.69
16 0.61
17 0.56
18 0.45
19 0.37
20 0.35
21 0.34
22 0.33
23 0.29
24 0.34
25 0.38
26 0.42
27 0.47
28 0.52
29 0.49
30 0.55
31 0.62
32 0.6
33 0.61
34 0.59
35 0.58
36 0.57
37 0.59
38 0.5
39 0.45
40 0.42
41 0.36
42 0.38
43 0.39
44 0.4
45 0.35
46 0.43
47 0.49
48 0.57
49 0.64
50 0.67
51 0.68
52 0.72
53 0.78
54 0.78
55 0.74
56 0.69
57 0.64
58 0.64
59 0.61
60 0.57
61 0.51
62 0.48
63 0.42
64 0.38
65 0.36
66 0.33
67 0.36
68 0.4
69 0.46
70 0.49
71 0.59
72 0.66
73 0.7
74 0.68
75 0.63
76 0.59
77 0.55
78 0.55
79 0.56
80 0.57
81 0.59
82 0.67
83 0.65
84 0.64
85 0.63
86 0.61