Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2LIG0

Protein Details
Accession A0A1Y2LIG0    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
92-117SKKAAPKTPKTPKTPRAKKAVKKATAHydrophilic
NLS Segment(s)
PositionSequence
91-115VSKKAAPKTPKTPKTPRAKKAVKKA
134-155TKGRKRGAKGEGKGEGGAKKVK
Subcellular Location(s) mito_nucl 10.832, mito 10.5, cyto_nucl 9.833, nucl 9.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MAKTWTPELQSILHQGVFEECNISISKALCEKIAARIRAANIEGFTECTPKAVENQLYKFKKKSTAAAAASPAAGAGAAGAAPSNPGSPSVSKKAAPKTPKTPKTPRAKKAVKKATAPEPEEGDEEELVSPSPTKGRKRGAKGEGKGEGGAKKVKTEPATPESDCFSAGQAEEEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.2
4 0.19
5 0.17
6 0.14
7 0.11
8 0.13
9 0.13
10 0.14
11 0.13
12 0.13
13 0.16
14 0.17
15 0.18
16 0.17
17 0.18
18 0.18
19 0.25
20 0.32
21 0.3
22 0.28
23 0.31
24 0.31
25 0.33
26 0.33
27 0.25
28 0.18
29 0.18
30 0.17
31 0.16
32 0.16
33 0.15
34 0.13
35 0.12
36 0.13
37 0.11
38 0.14
39 0.17
40 0.22
41 0.26
42 0.3
43 0.4
44 0.43
45 0.46
46 0.46
47 0.43
48 0.46
49 0.43
50 0.44
51 0.41
52 0.45
53 0.44
54 0.43
55 0.41
56 0.33
57 0.31
58 0.25
59 0.17
60 0.08
61 0.06
62 0.04
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.03
71 0.03
72 0.03
73 0.04
74 0.06
75 0.07
76 0.12
77 0.16
78 0.18
79 0.2
80 0.24
81 0.3
82 0.35
83 0.39
84 0.42
85 0.48
86 0.56
87 0.62
88 0.66
89 0.69
90 0.71
91 0.77
92 0.81
93 0.77
94 0.77
95 0.79
96 0.78
97 0.8
98 0.81
99 0.75
100 0.7
101 0.69
102 0.68
103 0.66
104 0.61
105 0.52
106 0.45
107 0.41
108 0.36
109 0.32
110 0.24
111 0.16
112 0.14
113 0.12
114 0.1
115 0.08
116 0.08
117 0.07
118 0.06
119 0.12
120 0.18
121 0.23
122 0.3
123 0.4
124 0.49
125 0.57
126 0.66
127 0.7
128 0.74
129 0.73
130 0.73
131 0.68
132 0.6
133 0.53
134 0.47
135 0.39
136 0.32
137 0.33
138 0.26
139 0.26
140 0.28
141 0.33
142 0.33
143 0.36
144 0.4
145 0.4
146 0.46
147 0.43
148 0.42
149 0.4
150 0.37
151 0.33
152 0.26
153 0.21
154 0.18
155 0.16