Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2MG83

Protein Details
Accession A0A1Y2MG83    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-40QSARIKKNKKVNNIKFKVRCHydrophilic
NLS Segment(s)
PositionSequence
26-27KK
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPAEVSDIKQFIEICRRKDAQSARIKKNKKVNNIKFKVRCSRNVYTLVLKDTDKAEKLKQSLPPGLTISDVGKKNPKGRHAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.38
3 0.4
4 0.39
5 0.47
6 0.5
7 0.49
8 0.54
9 0.6
10 0.62
11 0.69
12 0.72
13 0.72
14 0.75
15 0.72
16 0.73
17 0.75
18 0.75
19 0.77
20 0.79
21 0.82
22 0.77
23 0.76
24 0.75
25 0.68
26 0.65
27 0.62
28 0.59
29 0.54
30 0.52
31 0.48
32 0.42
33 0.39
34 0.33
35 0.27
36 0.23
37 0.2
38 0.18
39 0.19
40 0.18
41 0.19
42 0.21
43 0.24
44 0.27
45 0.31
46 0.34
47 0.37
48 0.4
49 0.39
50 0.38
51 0.35
52 0.32
53 0.28
54 0.24
55 0.21
56 0.23
57 0.23
58 0.24
59 0.31
60 0.36
61 0.43
62 0.48
63 0.52