Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2LYL2

Protein Details
Accession A0A1Y2LYL2    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPSATGGKKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 17, mito_nucl 12.499, cyto_nucl 11.333, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPSATGGKKQKKKWSKGKVKDKAQHAVVLDKNVTDKLNKDVQSYRLITVATLVDRLKINGSLARKALKDLEANGQIKKVVSHSKLAVYSASTPEGASPRPGPQQKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.88
4 0.9
5 0.93
6 0.92
7 0.93
8 0.9
9 0.86
10 0.82
11 0.73
12 0.66
13 0.56
14 0.52
15 0.43
16 0.38
17 0.31
18 0.24
19 0.23
20 0.2
21 0.2
22 0.14
23 0.14
24 0.15
25 0.22
26 0.22
27 0.25
28 0.26
29 0.28
30 0.33
31 0.33
32 0.29
33 0.23
34 0.22
35 0.19
36 0.17
37 0.14
38 0.09
39 0.09
40 0.08
41 0.09
42 0.09
43 0.09
44 0.09
45 0.09
46 0.09
47 0.11
48 0.13
49 0.14
50 0.15
51 0.18
52 0.17
53 0.18
54 0.2
55 0.19
56 0.18
57 0.18
58 0.23
59 0.27
60 0.28
61 0.27
62 0.26
63 0.24
64 0.23
65 0.22
66 0.2
67 0.21
68 0.21
69 0.25
70 0.26
71 0.3
72 0.31
73 0.31
74 0.27
75 0.22
76 0.22
77 0.2
78 0.2
79 0.16
80 0.15
81 0.17
82 0.19
83 0.18
84 0.2
85 0.2
86 0.24
87 0.33