Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2M592

Protein Details
Accession A0A1Y2M592    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-27DSSGPSRSRRPRASSSSPPRRNRALSHydrophilic
133-157APVASPHTRKNPRKRRAEDRPRVSGBasic
NLS Segment(s)
PositionSequence
140-215TRKNPRKRRAEDRPRVSGIRKADKKRILPPKSEPKFPSPITERVLVREMQRREQERRRERIRERSDARNHAPNRKP
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
Amino Acid Sequences MDSSGPSRSRRPRASSSSPPRRNRALSSTPPRVFEDPPLTPLTPLHPNPNPNPTPSSRPSPKPSASISLPGSRRSSLAPLTPLAPSNPLTPLVTNHTVTFTTSPDSTVLDHDATGEARNATGENASPSPSPSAPVASPHTRKNPRKRRAEDRPRVSGIRKADKKRILPPKSEPKFPSPITERVLVREMQRREQERRRERIRERSDARNHAPNRKPFEPRDGGHGLARLNADVMAALGRLAPPSELREQAVAELTEELAQLKIPDPLTVRARAWSNALIGGERGPGEGGAVEESAVEEDEHAVDECAVQDDHAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.83
4 0.84
5 0.85
6 0.85
7 0.83
8 0.82
9 0.78
10 0.73
11 0.71
12 0.69
13 0.69
14 0.71
15 0.74
16 0.69
17 0.67
18 0.65
19 0.59
20 0.52
21 0.49
22 0.47
23 0.38
24 0.39
25 0.41
26 0.36
27 0.33
28 0.32
29 0.29
30 0.3
31 0.3
32 0.35
33 0.35
34 0.41
35 0.45
36 0.53
37 0.51
38 0.46
39 0.49
40 0.45
41 0.48
42 0.47
43 0.52
44 0.5
45 0.56
46 0.59
47 0.62
48 0.61
49 0.58
50 0.57
51 0.53
52 0.48
53 0.47
54 0.43
55 0.42
56 0.41
57 0.4
58 0.39
59 0.33
60 0.32
61 0.28
62 0.28
63 0.23
64 0.25
65 0.23
66 0.21
67 0.22
68 0.22
69 0.21
70 0.18
71 0.18
72 0.16
73 0.15
74 0.15
75 0.15
76 0.15
77 0.15
78 0.16
79 0.2
80 0.22
81 0.22
82 0.2
83 0.21
84 0.2
85 0.21
86 0.2
87 0.14
88 0.13
89 0.12
90 0.13
91 0.12
92 0.12
93 0.12
94 0.12
95 0.13
96 0.11
97 0.11
98 0.1
99 0.1
100 0.1
101 0.1
102 0.09
103 0.07
104 0.07
105 0.07
106 0.07
107 0.07
108 0.07
109 0.06
110 0.08
111 0.08
112 0.1
113 0.1
114 0.1
115 0.13
116 0.12
117 0.13
118 0.11
119 0.12
120 0.11
121 0.14
122 0.18
123 0.23
124 0.26
125 0.29
126 0.38
127 0.46
128 0.55
129 0.63
130 0.69
131 0.72
132 0.8
133 0.83
134 0.83
135 0.85
136 0.87
137 0.86
138 0.82
139 0.79
140 0.71
141 0.66
142 0.58
143 0.51
144 0.45
145 0.45
146 0.46
147 0.44
148 0.49
149 0.53
150 0.56
151 0.6
152 0.65
153 0.59
154 0.57
155 0.6
156 0.64
157 0.61
158 0.63
159 0.57
160 0.51
161 0.53
162 0.49
163 0.47
164 0.41
165 0.42
166 0.38
167 0.4
168 0.35
169 0.31
170 0.33
171 0.28
172 0.27
173 0.3
174 0.29
175 0.31
176 0.37
177 0.4
178 0.46
179 0.53
180 0.6
181 0.62
182 0.69
183 0.71
184 0.74
185 0.76
186 0.79
187 0.78
188 0.77
189 0.72
190 0.73
191 0.73
192 0.71
193 0.68
194 0.66
195 0.63
196 0.63
197 0.65
198 0.63
199 0.63
200 0.61
201 0.63
202 0.57
203 0.62
204 0.58
205 0.52
206 0.52
207 0.46
208 0.42
209 0.37
210 0.36
211 0.27
212 0.23
213 0.23
214 0.15
215 0.13
216 0.11
217 0.09
218 0.07
219 0.07
220 0.05
221 0.04
222 0.04
223 0.04
224 0.04
225 0.05
226 0.05
227 0.06
228 0.07
229 0.11
230 0.15
231 0.16
232 0.17
233 0.18
234 0.18
235 0.19
236 0.2
237 0.16
238 0.13
239 0.12
240 0.11
241 0.1
242 0.1
243 0.09
244 0.07
245 0.07
246 0.07
247 0.08
248 0.11
249 0.11
250 0.14
251 0.16
252 0.22
253 0.26
254 0.29
255 0.29
256 0.3
257 0.32
258 0.31
259 0.32
260 0.28
261 0.25
262 0.23
263 0.23
264 0.19
265 0.17
266 0.17
267 0.15
268 0.12
269 0.12
270 0.09
271 0.08
272 0.08
273 0.08
274 0.08
275 0.07
276 0.07
277 0.07
278 0.07
279 0.07
280 0.07
281 0.08
282 0.07
283 0.06
284 0.07
285 0.07
286 0.09
287 0.09
288 0.09
289 0.08
290 0.09
291 0.09
292 0.11
293 0.1