Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2MEG2

Protein Details
Accession A0A1Y2MEG2   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
95-120RPNTCLFCPKRTPKKTPPPADEQNAHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MRQARQQLPISELTLYEHFRQYLPRFKYCDWSPHTQGEIWHLSLTVEAISIAEDPLKVYYSNMKTCSIHTPALKIEVRNKSSTLQNRHRSSLGIRPNTCLFCPKRTPKKTPPPADEQNAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.23
4 0.23
5 0.22
6 0.22
7 0.29
8 0.3
9 0.37
10 0.39
11 0.43
12 0.46
13 0.46
14 0.54
15 0.5
16 0.53
17 0.49
18 0.51
19 0.49
20 0.48
21 0.48
22 0.41
23 0.39
24 0.35
25 0.32
26 0.25
27 0.21
28 0.17
29 0.15
30 0.13
31 0.13
32 0.07
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.05
43 0.06
44 0.05
45 0.06
46 0.12
47 0.16
48 0.19
49 0.2
50 0.22
51 0.22
52 0.24
53 0.28
54 0.25
55 0.25
56 0.23
57 0.23
58 0.21
59 0.27
60 0.27
61 0.24
62 0.28
63 0.33
64 0.35
65 0.35
66 0.36
67 0.32
68 0.38
69 0.45
70 0.47
71 0.49
72 0.56
73 0.58
74 0.6
75 0.58
76 0.53
77 0.48
78 0.47
79 0.46
80 0.46
81 0.43
82 0.44
83 0.47
84 0.48
85 0.45
86 0.45
87 0.39
88 0.38
89 0.47
90 0.53
91 0.6
92 0.66
93 0.75
94 0.77
95 0.85
96 0.89
97 0.89
98 0.85
99 0.83
100 0.84